Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 4.300 2.1e-12
lung carcinoma -1.800 1.8e-09
nasopharyngeal carcinoma -1.600 2.5e-05
non-small cell lung carcinoma -1.400 7.0e-17
osteosarcoma -3.530 1.2e-10

AA Sequence

MMMSDNAKGRAAHSWKKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQL      1 - 70
GPPKHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQ     71 - 140
SILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE                                   141 - 179
//

Text Mined References (6)

PMID Year Title