Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.53
PubTator Score 1.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0

Expression

Synonym

Accession Q8N7K0 Q86VX3
Symbols

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20598377 ZNF433 has been identified as a candidate gene in a genome-wide association study of German multiple sclerosis patients.
20598377 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MMFQDSVAFEDVAVTFTQEEWALLDPSQKNLCRDVMQETFRNLASIGKKWKPQNIYVEYENLRRNLRIVG      1 - 70
ERLFESKEGHQHGEILTQVPDDMLKKTTTGVKSCESSVYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQK     71 - 140
PYKCKYCKKPFNCLSSVQTHERAHSGRKLYVCEECGKTFISHSNLQRHRIMHRGDGPYKCKFCGKALMFL    141 - 210
SLYLIHKRTHTGEKPYQCKQCGKAFSHSSSLRIHERTHTGEKPYKCNECGKAFHSSTCLHAHKRTHTGEK    211 - 280
PYECKQCGKAFSSSHSFQIHERTHTGEKPYECKECGKAFKCPSSVRRHERTHSRKKPYECKHCGKVLSYL    281 - 350
TSFQNHLGMHTGEISHKCKICGKAFYSPSSLQTHEKTHTGEKPYKCNQCGKAFNSSSSFRYHERTHTGEK    351 - 420
PYECKQCGKAFRSASLLQTHGRTHTGEKPYACKECGKPFSNFSFFQIHERMHREEKPYECKGYGKTFSLP    421 - 490
SLFHRHERTHTGGKTYECKQCGRSFNCSSSFRYHGRTHTGEKPYECKQCGKAFRSASQLQIHGRTHTGEK    491 - 560
PYECKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFGCASRLQMHGRTHTGEKPYKCKQCGKAFGCP    561 - 630
SNLRRHGRTHTGEKPYKCNQCGKVFRCSSQLQVHGRAHCIDTP                               631 - 673
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20598377 2010 Evidence for VAV2 and ZNF433 as susceptibility genes for multiple sclerosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.