Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.39
PubTator Score 2.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 4.5e-04
Astrocytoma, Pilocytic -1.300 2.5e-05
atypical teratoid / rhabdoid tumor -1.800 9.7e-04
ependymoma -1.200 7.6e-03
glioblastoma -1.300 5.4e-05
non primary Sjogren syndrome sicca -1.400 2.1e-02
subependymal giant cell astrocytoma -3.322 1.9e-03

Gene RIF (3)

AA Sequence

METSRSRGGGGAVSERGGAGASVGVCRRKAEAGAGTGTLAADMDLHCDCAAETPAAEPPSGKINKAAFKL      1 - 70
FKKRKSGGTMPSIFGVKNKGDGKSSGPTGLVRSRTHDGLAEVLVLESGRKEEPRGGGDSGGGGGGRPNPG     71 - 140
PPRAAGPGGGSLASSSVAKSHSFFSLLKKNGRSENGKGEPVDASKAGGKQKRGLRGLFSGMRWHRKDKRA    141 - 210
KAEAAEGRAPGGGLILPGSLTASLECVKEETPRAAREPEEPSQDAPRDPAGEPAGGEEVPAPADRAPARS    211 - 280
CREAEGLAHPGDTGARGEDAAGHRRAEPGPGEVRTAEDASRTGAVPVKTVPLVDSEGGSGRAPAAPDPAS    281 - 350
VDPPSDPSADRICLMFSDVTSLKSFDSLTGCGDIIADQEEEAGPSCDKHVPGPGKPALSKKNPGVVAYQG    351 - 420
GGEEMASPDEVDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKR    421 - 490
RRLNRIPIEPHPKEEPKHPEKEQQEGVPNSDEGYWDSTTPGPEEDSSSSGKKAGIPRDSYSGDALYDLYA    491 - 560
DPDGSPATLPGGKDNEETSSLSRLKPVSPGTITCPLRTPGSLLKDSKIPISIKHLTNLPSSHPVVHQQPS    561 - 630
RSEMPRTKIPVSKVLVRRVSNRGLAGTTIRATACHDSAKKL                                 631 - 671
//

Text Mined References (13)

PMID Year Title