Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.39
PubTator Score 2.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -2.800 0.001
ependymoma -1.500 0.001
atypical teratoid / rhabdoid tumor -4.200 0.001
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.000 0.000
non primary Sjogren syndrome sicca -1.400 0.021
subependymal giant cell astrocytoma -5.031 0.028

Gene RIF (3)

PMID Text
22949735 FAM123A binds to microtubules and inhibits the guanine nucleotide exchange factor ARHGEF2 to decrease actomyosin contractility.
22898821 the Amer2-EB1-APC complex regulates cell migration by altering microtubule stability.
22128170 data characterize Amer2 for the first time as a negative regulator of Wnt signaling both in cell lines and in vivo and define Amer proteins as a novel family of Wnt pathway regulators.

AA Sequence

METSRSRGGGGAVSERGGAGASVGVCRRKAEAGAGTGTLAADMDLHCDCAAETPAAEPPSGKINKAAFKL      1 - 70
FKKRKSGGTMPSIFGVKNKGDGKSSGPTGLVRSRTHDGLAEVLVLESGRKEEPRGGGDSGGGGGGRPNPG     71 - 140
PPRAAGPGGGSLASSSVAKSHSFFSLLKKNGRSENGKGEPVDASKAGGKQKRGLRGLFSGMRWHRKDKRA    141 - 210
KAEAAEGRAPGGGLILPGSLTASLECVKEETPRAAREPEEPSQDAPRDPAGEPAGGEEVPAPADRAPARS    211 - 280
CREAEGLAHPGDTGARGEDAAGHRRAEPGPGEVRTAEDASRTGAVPVKTVPLVDSEGGSGRAPAAPDPAS    281 - 350
VDPPSDPSADRICLMFSDVTSLKSFDSLTGCGDIIADQEEEAGPSCDKHVPGPGKPALSKKNPGVVAYQG    351 - 420
GGEEMASPDEVDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKR    421 - 490
RRLNRIPIEPHPKEEPKHPEKEQQEGVPNSDEGYWDSTTPGPEEDSSSSGKKAGIPRDSYSGDALYDLYA    491 - 560
DPDGSPATLPGGKDNEETSSLSRLKPVSPGTITCPLRTPGSLLKDSKIPISIKHLTNLPSSHPVVHQQPS    561 - 630
RSEMPRTKIPVSKVLVRRVSNRGLAGTTIRATACHDSAKKL                                 631 - 671
//

Text Mined References (13)

PMID Year Title
22949735 2012 FAM123A binds to microtubules and inhibits the guanine nucleotide exchange factor ARHGEF2 to decrease actomyosin contractility.
22898821 2012 Amer2 protein interacts with EB1 protein and adenomatous polyposis coli (APC) and controls microtubule stability and cell migration.
22128170 2012 Amer2 protein is a novel negative regulator of Wnt/?-catenin signaling involved in neuroectodermal patterning.
20843316 2010 The WTX/AMER1 gene family: evolution, signature and function.
17925383 2007 AMER1 regulates the distribution of the tumor suppressor APC between microtubules and the plasma membrane.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
More...