Property Summary

NCBI Gene PubMed Count 33
PubMed Score 402.84
PubTator Score 236.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 8.8e-05
ovarian cancer 8491 4.3e-04
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Vulvitis 5 3.313 1.7
Exophthalmos 16 3.035 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.165 8.8e-05
ovarian cancer 1.600 4.3e-04

Protein-protein Interaction (8)

Gene RIF (25)

PMID Text
26687678 Propose that degradation of MYC limits the accumulation of MYC/PAF1C complexes during transcriptional activation.
26659056 this study found that Pol II-associated factor 1 (PAF1) is a critical regulator of paused Pol II release, that positive transcription elongation factor b (P-TEFb) directly regulates the initial recruitment of PAF1 complex (PAF1C) to genes, and that the subsequent recruitment of CDK12 is dependent on PAF1C.
26282204 Mechanistic studies indicated that PAF1C could promote lung cancer cell proliferation through regulating c-MYC transcription.
26279188 This study reveals an evolutionarily conserved role for PAF1 as a regulator of promoter-proximal pausing by RNA Pol II in all metazoans, including human.
25933433 CNOT4 controls the degradation of chromatin-unbound PAF1 via the 26S proteasome.
25003666 PD2 is a novel cancer stem cell (CSC) maintenance protein, loss of which renders the CSCs more susceptible to drug-induced cell death.
24600005 Together, these results indicate that human adenovirus E1A uses hBre1 to recruit the hPaf1 complex in order to optimally activate viral early transcription by enhancing transcriptional elongation.
24565118 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
24101474 Data indicate that the Plus3 domain of the Rtf1 subunit mediates Paf1C recruitment to genes by binding a repeating domain within the phosphorylated elongation factor Spt5.
24038468 The results show that the Paf1/Leo1 heterodimer is necessary for its binding to histone H3, the histone octamer, and nucleosome in vitro.
23785282 E1A changes the function of hBre1 from a ubiquitin ligase involved in substrate selection to a scaffold which recruits hPaf1 as a means to stimulate transcription and transcription-coupled histone modifications.
23008333 Data show that activation-induced deaminase (AID) associates with RNA polymerase-associated factor 1 (PAF1) through its N-terminal domain.
22567366 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22451921 PAF1c acts as an arginine methyl histone effector that is recruited to promoters and activates a subset of genes, including targets of estrogen signaling.
22405323 Knockdown of Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22355797 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22082156 Knockdown of Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
22046413 that hPaf1/PD2 in association with MLL1 regulates methylation of H3K4 residues, as well as interacts and regulates nuclear shuttling of chromatin remodeling protein CHD1, facilitating its function in pancreatic cancer cells
21037944 Interaction between the Polymerase Associated Factor complex and Mixed Lineage Leukemia is critical for gene rearranged leukemogenesis.
20541477 MLL interacts directly with the polymerase associated factor complex (PAFc) via Paf1 and CTR9. PAFc augments MLL and MLL-AF9 mediated transcriptional activation of Hoxa9 and their interaction is essential for leukemogenesis.
20471949 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
20178742 Study demonstrates the ability of human PAF1C to facilitate activator p53- and histone acetyltransferase p300-dependent transcription elongation from a recombinant chromatin template in a biochemically defined RNA polymerase II transcription system.
19771162 hPaf1 and the hPAF complex are key regulators of cell-cycle progression
16491129 Overexpression of PD2/hPaf1 is involved in cancer development.
16307923 Formation of trimeric complex UbcH6 and RNF20/40 with PAF stimulates histone 2B monoubiquitination activity in vitro

AA Sequence

MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQH      1 - 70
KHDLLTEPDLGVTIDLINPDTYRIDPNVLLDPADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTE     71 - 140
FNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTPVEVMPVFPD    141 - 210
FKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMD    211 - 280
YAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRRAKAGVQSGTNALLV    281 - 350
VKHRDMNEKELEAQEARKAQLENHEPEEEEEEEMETEEKEAGGSDEEQEKGSSSEKEGSEDEHSGSESER    351 - 420
EEGDRDEASDKSGSGEDESSEDEARAARDKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGG    421 - 490
QRSRSHSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD                                 491 - 531
//

Text Mined References (41)

PMID Year Title
26687678 2016 Ubiquitin-Dependent Turnover of MYC Antagonizes MYC/PAF1C Complex Accumulation to Drive Transcriptional Elongation.
26659056 2015 RNA polymerase II-associated factor 1 regulates the release and phosphorylation of paused RNA polymerase II.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26282204 2015 Human RNA polymerase II associated factor 1 complex promotes tumorigenesis by activating c-MYC transcription in non-small cell lung cancer.
26279188 2015 PAF1, a Molecular Regulator of Promoter-Proximal Pausing by RNA Polymerase II.
25933433 2015 Protein Degradation of RNA Polymerase II-Association Factor 1(PAF1) Is Controlled by CNOT4 and 26S Proteasome.
25416956 2014 A proteome-scale map of the human interactome network.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25003666 2014 Novel role of pancreatic differentiation 2 in facilitating self-renewal and drug resistance of pancreatic cancer stem cells.
24600005 2014 Adenovirus E1A recruits the human Paf1 complex to enhance transcriptional elongation.
24101474 2013 Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
24038468 2013 Structural insights into Paf1 complex assembly and histone binding.
23785282 2013 Viral retasking of hBre1/RNF20 to recruit hPaf1 for transcriptional activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23008333 2012 A role for the RNA pol II-associated PAF complex in AID-induced immune diversification.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22451921 2012 Histone H3R17me2a mark recruits human RNA polymerase-associated factor 1 complex to activate transcription.
22419161 2012 Suppression of the antiviral response by an influenza histone mimic.
22046413 2011 Human RNA polymerase II-association factor 1 (hPaf1/PD2) regulates histone methylation and chromatin remodeling in pancreatic cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21329879 2011 Transcriptional activators enhance polyadenylation of mRNA precursors.
21269460 2011 Initial characterization of the human central proteome.
21037944 2010 PAFc, a key player in MLL-rearranged leukemogenesis.
20541477 2010 The PAF complex synergizes with MLL fusion proteins at HOX loci to promote leukemogenesis.
20178742 2010 The human PAF1 complex acts in chromatin transcription elongation both independently and cooperatively with SII/TFIIS.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19952111 2009 DSIF, the Paf1 complex, and Tat-SF1 have nonredundant, cooperative roles in RNA polymerase II elongation.
19771162 2009 The human RNA polymerase II-associated factor 1 (hPaf1): a new regulator of cell-cycle progression.
19410543 2009 RAD6-Mediated transcription-coupled H2B ubiquitylation directly stimulates H3K4 methylation in human cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16491129 2006 The human homologue of the RNA polymerase II-associated factor 1 (hPaf1), localized on the 19q13 amplicon, is associated with tumorigenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16024656 2005 The human PAF complex coordinates transcription with events downstream of RNA synthesis.
15923622 2005 The HRPT2 tumor suppressor gene product parafibromin associates with human PAF1 and RNA polymerase II.
15632063 2005 The parafibromin tumor suppressor protein is part of a human Paf1 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.