Property Summary

NCBI Gene PubMed Count 33
Grant Count 8
Funding $1,098,777.57
PubMed Score 402.84
PubTator Score 236.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (5)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.165 0.000
ovarian cancer 1.600 0.000

Gene RIF (25)

PMID Text
26687678 Propose that degradation of MYC limits the accumulation of MYC/PAF1C complexes during transcriptional activation.
26659056 this study found that Pol II-associated factor 1 (PAF1) is a critical regulator of paused Pol II release, that positive transcription elongation factor b (P-TEFb) directly regulates the initial recruitment of PAF1 complex (PAF1C) to genes, and that the subsequent recruitment of CDK12 is dependent on PAF1C.
26282204 Mechanistic studies indicated that PAF1C could promote lung cancer cell proliferation through regulating c-MYC transcription.
26279188 This study reveals an evolutionarily conserved role for PAF1 as a regulator of promoter-proximal pausing by RNA Pol II in all metazoans, including human.
25933433 CNOT4 controls the degradation of chromatin-unbound PAF1 via the 26S proteasome.
25003666 PD2 is a novel cancer stem cell (CSC) maintenance protein, loss of which renders the CSCs more susceptible to drug-induced cell death.
24600005 Together, these results indicate that human adenovirus E1A uses hBre1 to recruit the hPaf1 complex in order to optimally activate viral early transcription by enhancing transcriptional elongation.
24565118 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
24101474 Data indicate that the Plus3 domain of the Rtf1 subunit mediates Paf1C recruitment to genes by binding a repeating domain within the phosphorylated elongation factor Spt5.
24038468 The results show that the Paf1/Leo1 heterodimer is necessary for its binding to histone H3, the histone octamer, and nucleosome in vitro.
More...

AA Sequence

MAPTIQTQAQREDGHRPNSHRTLPERSGVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQH      1 - 70
KHDLLTEPDLGVTIDLINPDTYRIDPNVLLDPADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTE     71 - 140
FNRYGISNEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTPVEVMPVFPD    141 - 210
FKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMD    211 - 280
YAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRRAKAGVQSGTNALLV    281 - 350
VKHRDMNEKELEAQEARKAQLENHEPEEEEEEEMETEEKEAGGSDEEQEKGSSSEKEGSEDEHSGSESER    351 - 420
EEGDRDEASDKSGSGEDESSEDEARAARDKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGG    421 - 490
QRSRSHSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD                                 491 - 531
//

Text Mined References (41)

PMID Year Title
26687678 2016 Ubiquitin-Dependent Turnover of MYC Antagonizes MYC/PAF1C Complex Accumulation to Drive Transcriptional Elongation.
26659056 2015 RNA polymerase II-associated factor 1 regulates the release and phosphorylation of paused RNA polymerase II.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26282204 2015 Human RNA polymerase II associated factor 1 complex promotes tumorigenesis by activating c-MYC transcription in non-small cell lung cancer.
26279188 2015 PAF1, a Molecular Regulator of Promoter-Proximal Pausing by RNA Polymerase II.
25933433 2015 Protein Degradation of RNA Polymerase II-Association Factor 1(PAF1) Is Controlled by CNOT4 and 26S Proteasome.
25416956 2014 A proteome-scale map of the human interactome network.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25003666 2014 Novel role of pancreatic differentiation 2 in facilitating self-renewal and drug resistance of pancreatic cancer stem cells.
24600005 2014 Adenovirus E1A recruits the human Paf1 complex to enhance transcriptional elongation.
More...