Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.0e-08
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.526 2.0e-08

Synonym

Accession Q8N7H1 B2RMN9 Q3ZCV4
Symbols C12orf61

 Compartment GO Term (1)

AA Sequence

MGGKSAVRHQLVLDCPREAASSAPALRPLGAAATSRAAPLAPLPAPSPRWGLGCGRVRYPGPHPRRAVEP      1 - 70
AAGPLSAPIIAGGHPAEAAAGSAKQQPRHSREVPRPPVPQHPSGNSRSALQEAKTEQTKTP              71 - 131
//

Text Mined References (4)

PMID Year Title