Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.01
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.3e-11
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.4

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.259 1.3e-11

AA Sequence

MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVI      1 - 70
MQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAE     71 - 140
EPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ                                        141 - 174
//

Text Mined References (8)

PMID Year Title