Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.01
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 2.259 0.000

AA Sequence

MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVI      1 - 70
MQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAE     71 - 140
EPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ                                        141 - 174
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16872915 2007 Ubl4b, an X-derived retrogene, is specifically expressed in post-meiotic germ cells in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.