Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 0.000

Gene RIF (1)

PMID Text
24089095 We identified a novel human testicular interstitial gene and observed that histone deacetylases regulate RNF148 expression.

AA Sequence

MSFLRITPSTHSSVSSGLLRLSIFLLLSFPDSNGKAIWTAHLNITFQVGNEITSELGESGVFGNHSPLER      1 - 70
VSGVVALPEGWNQNACHPLTNFSRPKQADSWLALIERGGCTFTHKINVAAEKGANGVIIYNYQGTGSKVF     71 - 140
PMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCV    141 - 210
WRLTPRVPNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKPQDVVRILTCKHFF    211 - 280
HKACIDPWLLAHRTCPMCKCDILKT                                                 281 - 305
//

Text Mined References (7)

PMID Year Title
24089095 2013 Identification of a novel human testicular interstitial gene, RNF148, and its expression regulated by histone deacetylases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8744354 1996 Does this have a familiar RING?