Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.78
PubTator Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 4.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.122 4.5e-04

Synonym

Accession Q8N7C4 Q8TC54
Symbols C6orf128
dJ355M6.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MKQQQWCGMTAKMGTVLSGVFTIMAVDMYLIFEQKHLGNGSCTEITPKYRGASNIINNFIICWSFKIVLF      1 - 70
LSFITILISCFLLYSVYAQIFRGLVIYIVWIFFYETANVVIQILTNNDFDIKEVRIMRWFGLVSRTVMHC     71 - 140
FWMFFVINYAHITYKNRSQGNIISYKRRISTAEILHSRNKRLSISSGFSGSHLESQYFERQSFHTSIFTC    141 - 210
LSPVPSSAPSTCRYTIDVC                                                       211 - 229
//

Text Mined References (8)

PMID Year Title