Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.07
PubTator Score 0.98

Knowledge Summary

Patent (107)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.6e-10
medulloblastoma, large-cell 6241 1.7e-05
psoriasis 6694 2.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.7e-05
osteosarcoma 2.380 8.6e-10
psoriasis -1.800 2.1e-04

Gene RIF (3)

AA Sequence

MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPA      1 - 70
MHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFTFSVLSNLVQLNIANNPHLLS     71 - 140
LHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLFLSGNPWKCNCSFLDFAIFLIVFHMDPSDDL    141 - 210
NATCVEPTELTGWPITRVGNPLRYMCITHLDHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTRHKS    211 - 280
SEEDEDEAGTRVEVSRRIFQTQTSSVQEFPQLI                                         281 - 313
//

Text Mined References (9)

PMID Year Title