Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $69,149.34
PubMed Score 1.86
PubTator Score 0.98

Knowledge Summary

Patent (107)

TINX Plot

  Disease Relevance (3)

Gene RIF (3)

PMID Text
26009545 Suggest that BK channel modulation by auxiliary gamma subunits depends on intra- and/or juxta-membrane mechanisms.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLASGPGPGWLLFSFGMGLVSGSKCPNNCLCQAQEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPA      1 - 70
MHLGLLSDLVYLDCQNNRIREVMDYTFIGVFKLIYLDLSSNNLTSISPFTFSVLSNLVQLNIANNPHLLS     71 - 140
LHKFTFANTTSLRYLDLRNTGLQTLDSAALYHLTTLETLFLSGNPWKCNCSFLDFAIFLIVFHMDPSDDL    141 - 210
NATCVEPTELTGWPITRVGNPLRYMCITHLDHKDYIFLLLIGFCIFAAGTVAAWLTGVCAVLYQNTRHKS    211 - 280
SEEDEDEAGTRVEVSRRIFQTQTSSVQEFPQLI                                         281 - 313
//

Text Mined References (9)

PMID Year Title
26009545 2015 Molecular basis for differential modulation of BK channel voltage-dependent gating by auxiliary ? subunits.
23129643 2012 Functional and structural analysis of the human SLO3 pH- and voltage-gated K+ channel.
22547800 2012 BK potassium channel modulation by leucine-rich repeat-containing proteins.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.