Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.82
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HORMAD2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HORMAD2
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that HORMAD2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with HORMAD2
24803422 Hormad1 and Hormad2 might not be the susceptible genes for the non-obstructive azoospermia in our study population. However, rs718772 of Hormad2 variant might be associated with testis development in NOA patients.
24797335 These findings indicate that polymorphisms at the CT gene HORMAD2 might be involved in the prognosis of advanced non-small-cell lung cancer in Han Chinese.
22893617 HORMAD2 is predominantly expressed in human testis and weakly expressed in liver. HORMAD2 is ectopically expressed in nearly 10% of lung cancer samples from Chinese Han individuals.
20473688 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKI      1 - 70
LREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSS     71 - 140
STSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLL    141 - 210
FDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFV    211 - 280
CSQQSSECSRKKRKVSEPVKVFIPNRK                                               281 - 307
//

Text Mined References (13)

PMID Year Title
24803422 2014 Genetic study of Hormad1 and Hormad2 with non-obstructive azoospermia patients in the male Chinese population.
24797335 2014 Association of polymorphisms at HORMAD2 and prognosis in advanced non-small-cell lung cancer patients.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22893617 2012 HORMAD2/CT46.2, a novel cancer/testis gene, is ectopically expressed in lung cancer tissues.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
20473688 2010 Association between genome-wide association studies reported SNPs and pediatric-onset Crohn's disease in Canadian children.
19915574 2009 Common variants at five new loci associated with early-onset inflammatory bowel disease.
15999985 2005 Identification of CT46/HORMAD1, an immunogenic cancer/testis antigen encoding a putative meiosis-related protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...