Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.47
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.257 0.040
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.200 0.000
lung adenocarcinoma -1.100 0.000
Pick disease -1.100 0.001
progressive supranuclear palsy -1.400 0.031
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.300 0.001
acute myeloid leukemia -1.600 0.034
ovarian cancer -2.300 0.000

Gene RIF (4)

PMID Text
23722832 The crystal structures of the apo form of the mutated Keap1 Kelch domain (1.98 A resolution) and of the complex with an Nrf2-derived peptide obtained by soaking (2.20 A resolution) are reported.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18095942 Blocking CCR4 and CCR10 simultaneously, or their ligands, should be beneficial in the treatment of T-cell-mediated skin diseases.
16964437 Data show that KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells.

AA Sequence

MADSQLFCVAEERSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHLMEGELPASMS      1 - 70
GSCGACINGKLYIFGGYDDKGYSNRLYFVNLRTRDETYIWEKITDFEGQPPTPRDKLSCWVYKDRLIYFG     71 - 140
GYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKTQTWFQPEIKGGVPPQPRAAHTCAVLGNKGY    141 - 210
IFGGRVLQTRMNDLHYLNLDTWTWSGRITINGESPKHRSWHTLTPIADDKLFLCGGLSADNIPLSDGWIH    211 - 280
NVTTNCWKQLTHLPKTRPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDC    281 - 350
IGKNSIMLESQISLLPPKLLQQVLKKITFWAAANHREEQRVQKEETENKYQWISSN                  351 - 406
//

Text Mined References (8)

PMID Year Title
23722832 2013 Crystal-contact engineering to obtain a crystal form of the Kelch domain of human Keap1 suitable for ligand-soaking experiments.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
18095942 2008 CCR4 and CCR10 ligands play additive roles in mouse contact hypersensitivity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964437 2007 Differential subcellular localization and activity of kelch repeat proteins KLHDC1 and KLHDC2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.