Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.47
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.600 3.4e-02
atypical teratoid / rhabdoid tumor -1.100 8.2e-06
Breast cancer -1.400 7.0e-06
invasive ductal carcinoma -1.300 1.4e-03
lung adenocarcinoma -1.100 1.3e-12
medulloblastoma, large-cell -1.200 2.9e-04
osteosarcoma -1.257 4.0e-02
ovarian cancer -2.300 4.9e-10
Pick disease -1.100 1.2e-03
progressive supranuclear palsy -1.400 3.1e-02

Synonym

Accession Q8N7A1 B3KXD9 Q8WYI1
Symbols MST025

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MADSQLFCVAEERSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYDIDSGLWRMHLMEGELPASMS      1 - 70
GSCGACINGKLYIFGGYDDKGYSNRLYFVNLRTRDETYIWEKITDFEGQPPTPRDKLSCWVYKDRLIYFG     71 - 140
GYGCRRHSELQDCFDVHDASWEEQIFWGWHNDVHIFDTKTQTWFQPEIKGGVPPQPRAAHTCAVLGNKGY    141 - 210
IFGGRVLQTRMNDLHYLNLDTWTWSGRITINGESPKHRSWHTLTPIADDKLFLCGGLSADNIPLSDGWIH    211 - 280
NVTTNCWKQLTHLPKTRPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDC    281 - 350
IGKNSIMLESQISLLPPKLLQQVLKKITFWAAANHREEQRVQKEETENKYQWISSN                  351 - 406
//

Text Mined References (8)

PMID Year Title