Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSSLTYHHRLHTGEKPYKCEECDKAFRHNSALQRHRRIHTGEKPHKCNECGKTFSQKSYLACHRSIHTGK      1 - 70
KPYECEECDKAFSFKSNLESHRITHTGEKPYKCNDCGKTFSHMSTLTCHRRLHTGEKPYKCEECDEAFRF     71 - 140
KSSLERHRRIHNGEKLYKCNECGKTFSQELSLTCHCRLHSGEKPCKCGECDKAYSFK                 141 - 197
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.