Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.84
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.500 2.7e-02
diabetes mellitus -1.200 3.7e-03
ependymoma -1.900 2.7e-02
glioblastoma 1.100 1.2e-04
group 3 medulloblastoma 1.100 7.4e-03
lung cancer 1.100 1.6e-02
malignant mesothelioma 1.300 3.6e-04
medulloblastoma, large-cell 1.300 9.0e-05
non-small cell lung cancer 1.470 1.6e-16
oligodendroglioma -1.800 1.8e-02
osteosarcoma 2.117 1.7e-05
ovarian cancer 1.200 3.1e-05
psoriasis -1.400 3.7e-03

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEKNVIAALNSRT      1 - 70
GEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESV     71 - 140
RYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIV    141 - 210
QQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQ    211 - 280
PNPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSED    281 - 350
GSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYR    351 - 420
ALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSS    421 - 490
QLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQY    491 - 560
LPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLP    561 - 630
VMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTI    631 - 700
PPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRII    701 - 770
HSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIF    771 - 840
PSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFI    841 - 910
NYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITK    911 - 980
RLAQVKLLNRAWR                                                             981 - 993
//

Text Mined References (19)

PMID Year Title