Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.397 4.1e-05
Astrocytoma, Pilocytic 1.100 7.4e-04
atypical teratoid / rhabdoid tumor 1.300 8.4e-04
Duchenne muscular dystrophy 1.282 1.0e-05
ependymoma 1.400 4.1e-07
fascioscapulohumeral muscular dystrophy 1.096 1.9e-05
glioblastoma 1.100 1.3e-02
group 4 medulloblastoma -1.400 2.4e-03
juvenile dermatomyositis 1.308 2.6e-11
lung carcinoma -1.400 2.4e-30
medulloblastoma, large-cell -1.300 1.1e-02
ovarian cancer -2.800 2.5e-07
pancreatic cancer 1.100 5.1e-03
pediatric high grade glioma 1.500 6.9e-04
primary pancreatic ductal adenocarcinoma 1.189 2.8e-03
tuberculosis 1.900 6.0e-09

AA Sequence

MEAALLGLCNWSTLGVCAALKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYLEYP      1 - 70
ILIAQDVILLLCIFHFNGNVKQATPYIAVLVSSWFILALQKWIIDLAMNLCTFISAASKFAQLQCLWKTR     71 - 140
DSGTVSALTWSLSSYTCATRIITTLMTTNDFTILLRFVIMLALNIWVTVTVLRYRKTAIKAE            141 - 202
//

Text Mined References (6)

PMID Year Title