Property Summary

NCBI Gene PubMed Count 68
PubMed Score 56.01
PubTator Score 18.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.1e-11
medulloblastoma, large-cell 6241 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Gene RIF (62)

AA Sequence

MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPE      1 - 70
LYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETV     71 - 140
ILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPS    141 - 210
DPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANF    211 - 280
PLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHLHVLIGTSVVIIPFAILLFFLLHRWCANK    281 - 350
KNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDTSV              351 - 410
//

Text Mined References (69)

PMID Year Title