Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 2
Funding $609,118.5
PubMed Score 12.43
PubTator Score 33.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.100 0.020
osteosarcoma 4.013 0.000
group 4 medulloblastoma 2.100 0.000
cystic fibrosis -1.655 0.008
juvenile dermatomyositis 1.847 0.000
acute quadriplegic myopathy 1.719 0.000
Breast cancer 2.800 0.028
spina bifida -1.325 0.041
Pick disease -1.100 0.000
ovarian cancer -2.100 0.000
pancreatic cancer 1.100 0.006

AA Sequence

MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYK      1 - 70
VRVGRLKHDITQVPETREVYKSEDRLERLQEILRKFLYLEREFRQITISKETFTSEKNNECHEPEKSFSL     71 - 140
DSTIDADQRVLRIQNTDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEK    141 - 210
SYKCDVCGKIFHQSSALTRHQRIHTREKPYKCKECEKSFSQSSSLSRHKRIHTREKPYKCEASDKSCEAS    211 - 280
DKSCSPSSGIIQHKKIHTRAKSYKCSSCERVFSRSVHLTQHQKIHKEMPCKCTVCGSDFCHTSYLLEHQR    281 - 350
VHHEEKAYEYDEYGLAYIKQQGIHFREKPYTCSECGKDFRLNSHLIQHQRIHTGEKAHECNECGKAFSQT    351 - 420
SCLIQHHKMHRKEKSYECNEYEGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLVQHQSIHTKEN    421 - 490
S//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24816252 2014 An atlas of genetic influences on human blood metabolites.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16341674 2005 Transcriptome analysis of human gastric cancer.
16314882 Sequence diversity and haplotype structure at the human CYP3A cluster.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15558030 2005 Characterization of VIK-1: a new Vav-interacting Kruppel-like protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...