Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.24
PubTator Score 33.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.719 5.4e-07
Breast cancer 2.800 2.8e-02
cystic fibrosis -1.655 8.1e-03
ependymoma -1.100 2.0e-02
group 3 medulloblastoma 1.300 4.5e-02
juvenile dermatomyositis 1.847 1.4e-13
osteosarcoma 4.013 1.9e-07
ovarian cancer -2.100 7.4e-06
pancreatic cancer 1.100 6.3e-03
Pick disease -1.100 1.4e-04
spina bifida -1.325 4.1e-02

AA Sequence

MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYK      1 - 70
VRVGRLKHDITQVPETREVYKSEDRLERLQEILRKFLYLEREFRQITISKETFTSEKNNECHEPEKSFSL     71 - 140
DSTIDADQRVLRIQNTDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEK    141 - 210
SYKCDVCGKIFHQSSALTRHQRIHTREKPYKCKECEKSFSQSSSLSRHKRIHTREKPYKCEASDKSCEAS    211 - 280
DKSCSPSSGIIQHKKIHTRAKSYKCSSCERVFSRSVHLTQHQKIHKEMPCKCTVCGSDFCHTSYLLEHQR    281 - 350
VHHEEKAYEYDEYGLAYIKQQGIHFREKPYTCSECGKDFRLNSHLIQHQRIHTGEKAHECNECGKAFSQT    351 - 420
SCLIQHHKMHRKEKSYECNEYEGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLVQHQSIHTKEN    421 - 490
S//

Text Mined References (17)

PMID Year Title