Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.05
PubTator Score 3.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 2.600 6.5e-06
astrocytic glioma 1.900 5.5e-03
Astrocytoma, Pilocytic 1.100 4.2e-02
Atopic dermatitis -1.600 1.1e-05
atypical teratoid / rhabdoid tumor 2.000 1.5e-02
cutaneous lupus erythematosus -1.300 8.6e-03
cystic fibrosis 1.814 7.1e-06
Duchenne muscular dystrophy 2.214 1.4e-10
glioblastoma 2.100 2.2e-04
group 3 medulloblastoma 1.300 1.5e-03
head and neck cancer -1.500 5.1e-04
invasive ductal carcinoma -1.900 1.1e-03
lung cancer 2.100 4.2e-03
medulloblastoma, large-cell 1.700 1.4e-03
osteosarcoma 1.914 7.1e-03
ovarian cancer -1.500 7.4e-06
Polycystic ovary syndrome 1.005 1.4e-02
primitive neuroectodermal tumor 2.300 1.4e-03
psoriasis -1.400 6.7e-06

Gene RIF (2)

AA Sequence

MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQER      1 - 70
KLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQ     71 - 140
IKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQ    141 - 210
LCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKI    211 - 280
NQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDN    281 - 350
PWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDE    351 - 420
WEKKHRDHTAKKQSVIITIVG                                                     421 - 441
//

Text Mined References (10)

PMID Year Title