Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.05
PubTator Score 3.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Duchenne muscular dystrophy 602 1.40535205643089E-10
adult high grade glioma 2148 6.52488082404594E-6
cystic fibrosis 1670 7.06401745595243E-6
ovarian cancer 8492 7.40102099159441E-6
Atopic dermatitis 944 1.12645331074614E-5
head and neck cancer 270 5.08335881885282E-4
sonic hedgehog group medulloblastoma 1482 5.14647428793058E-4
glioblastoma 5572 5.99158047410226E-4
invasive ductal carcinoma 2950 0.00112778921231651
primitive neuroectodermal tumor 3031 0.00136145143498263
medulloblastoma, large-cell 6234 0.00142653854683097
lung cancer 4473 0.00420157139018129
astrocytic glioma 2241 0.00553923049093762
osteosarcoma 7933 0.00706637088335771
cutaneous lupus erythematosus 1056 0.00860781601916481
Polycystic Ovary Syndrome 335 0.014493435115956
psoriasis 6685 0.0145817728125084
atypical teratoid / rhabdoid tumor 4369 0.0152925538087702
pilocytic astrocytoma 3086 0.0405316965598543

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.900 0.006
psoriasis -1.800 0.015
cutaneous lupus erythematosus -1.300 0.009
glioblastoma 2.600 0.001
osteosarcoma 1.914 0.007
sonic hedgehog group medulloblastoma 1.500 0.001
cystic fibrosis 1.814 0.000
atypical teratoid / rhabdoid tumor 2.000 0.015
medulloblastoma, large-cell 1.700 0.001
primitive neuroectodermal tumor 2.300 0.001
Duchenne muscular dystrophy 2.214 0.000
Atopic dermatitis -1.600 0.000
lung cancer 2.100 0.004
adult high grade glioma 2.600 0.000
pilocytic astrocytoma 1.100 0.041
Polycystic Ovary Syndrome 1.005 0.014
invasive ductal carcinoma -1.900 0.001
ovarian cancer -1.500 0.000
head and neck cancer -1.500 0.001

Synonym

Accession Q8N6Y2 Q13288 Q6UWA7 Q75MG5
Symbols P37NB

Gene

PANTHER Protein Class (1)

  Ortholog (11)

AA Sequence

MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQER      1 - 70
KLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQ     71 - 140
IKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQ    141 - 210
LCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKI    211 - 280
NQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDN    281 - 350
PWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDE    351 - 420
WEKKHRDHTAKKQSVIITIVG                                                     421 - 441
//

Text Mined References (8)

PMID Year Title
19336404 2009 Identification of LRRc17 as a negative regulator of receptor activator of NF-kappaB ligand (RANKL)-induced osteoclast differentiation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8982252 1996 A cDNA encoding a putative 37 kDa leucine-rich repeat (LRR) protein, p37NB, isolated from S-type neuroblastoma cell has a differential tissue distribution.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.