Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $447,099.34
PubMed Score 3.05
PubTator Score 3.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.900 0.006
psoriasis -1.800 0.015
cutaneous lupus erythematosus -1.300 0.009
glioblastoma 2.600 0.001
osteosarcoma 1.914 0.007
sonic hedgehog group medulloblastoma 1.500 0.001
cystic fibrosis 1.814 0.000
atypical teratoid / rhabdoid tumor 2.000 0.015
medulloblastoma, large-cell 1.700 0.001
primitive neuroectodermal tumor 2.300 0.001
Duchenne muscular dystrophy 2.214 0.000
Atopic dermatitis -1.600 0.000
lung cancer 2.100 0.004
adult high grade glioma 2.600 0.000
pilocytic astrocytoma 1.100 0.041
Polycystic Ovary Syndrome 1.005 0.014
invasive ductal carcinoma -1.900 0.001
ovarian cancer -1.500 0.000
head and neck cancer -1.500 0.001

AA Sequence

MRVVTIVILLCFCKAAELRKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQER      1 - 70
KLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQ     71 - 140
IKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQ    141 - 210
LCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKI    211 - 280
NQLRPKEFEDVHELKKLNLSSNGIEFIDPAAFLGLTHLEELDLSNNSLQNFDYGVLEDLYFLKLLWLRDN    281 - 350
PWRCDYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDE    351 - 420
WEKKHRDHTAKKQSVIITIVG                                                     421 - 441
//

Text Mined References (8)

PMID Year Title
19336404 2009 Identification of LRRc17 as a negative regulator of receptor activator of NF-kappaB ligand (RANKL)-induced osteoclast differentiation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8982252 1996 A cDNA encoding a putative 37 kDa leucine-rich repeat (LRR) protein, p37NB, isolated from S-type neuroblastoma cell has a differential tissue distribution.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.