Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.12
PubTator Score 6.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
adult high grade glioma 3801 3.3e-04
medulloblastoma, large-cell 6241 4.5e-04
osteosarcoma 7950 8.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Myeloid neoplasm 3 3.027 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.400 3.3e-04
medulloblastoma, large-cell -1.200 4.5e-04
osteosarcoma -1.065 8.5e-04

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MSARATRPRSRRGRHAPPGELDPVAESSEEVEAASGSSKPSFAPPPVSSGLEQLGPMEEVSGQGLGSRTD      1 - 70
KKMDGGSGRELASAPEVPHKPAVEAHQAPEAALQYKETVPPGNGAPDVFQTLQHTLSSLEAAAAAWRHQP     71 - 140
PSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKET    141 - 210
LQKEVQELQDSLLRLEPCPHLSHNQAGGSGSGSSSSEADREPWETQDSFSLAHPLLRRLRSHSSTQILGS    211 - 280
LPNQPLSPEMHIMEAQMEQLRGSIEKLKCFNRLLSAVLQGYKGRCEGLSMQLGQREAEATALHLALQYSE    281 - 350
HCEEAYRVLLALREADSGAGDEAPMSDLQAAEKEAWRLLAQEEAAMDAGAQQNPQPSPEGSSVDKPTPQE    351 - 420
VAFQLRSYVQRLQERRSLMKILSEPGPTLAPMPTVPRAEAMVQAILGTQAGPALPRLEKTQIQQDLVAAR    421 - 490
EALADLMLRLQLVRREKRGLELREAALRALGPAHVLLLEQLRWERAELQAGGANSSGGHSSGGGSSGDEE    491 - 560
EWYQGLPAVPGGTSGIDGGQVGRAWDPEKLAQELAASLTRTLDLQEQLQSLRRELEQVAQKGRARRSQSA    561 - 630
ELNRDLCKAHSALVLAFRGAHRKQEEQRRKLEQQMALMEAQQAEEVAVLEATARALGKPRPPLPPPQLGD    631 - 700
TFL                                                                       701 - 703
//

Text Mined References (13)

PMID Year Title