Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.1464070439662E-18
oligodendroglioma 2849 4.12485279115217E-14
psoriasis 6685 6.70552835258185E-13
Breast cancer 3099 1.2281699402815E-12
medulloblastoma, large-cell 6234 2.0983073287806E-8
atypical teratoid / rhabdoid tumor 4369 8.63924775388287E-8
glioblastoma 5572 1.50828432058752E-6
pediatric high grade glioma 2712 1.57463858028227E-6
ovarian cancer 8492 2.24728885161332E-5
pilocytic astrocytoma 3086 2.94184608832325E-5
group 3 medulloblastoma 2254 1.29137628324218E-4
astrocytic glioma 2241 0.00347900376175328
primitive neuroectodermal tumor 3031 0.0434439619447914
Disease Target Count Z-score Confidence
Liver disease 219 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.100 0.003
posterior fossa group B ependymoma -4.900 0.000
oligodendroglioma -1.900 0.000
glioblastoma -4.300 0.000
group 3 medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -5.300 0.000
primitive neuroectodermal tumor -2.100 0.043
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -2.600 0.000
Breast cancer -2.400 0.000
ovarian cancer -1.400 0.000
psoriasis -1.100 0.000

Synonym

Accession Q8N6W0 D6W614 O75253 Q59GP2 Q86VW6 Q9BZC0 Q9NR86 CELF-5
Symbols CELF-5
BRUNOL5
BRUNOL-5

Gene

PDB

2DNH  

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

AA Sequence

MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGR      1 - 70
IYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGM     71 - 140
LNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVK    141 - 210
FADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQI    211 - 280
GAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSP    281 - 350
TVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMF    351 - 420
LPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY         421 - 485
//

Text Mined References (7)

PMID Year Title
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
19757395 2010 Differential expression of the Brunol/CELF family genes during Xenopus laevis early development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11158314 2001 The CELF family of RNA binding proteins is implicated in cell-specific and developmentally regulated alternative splicing.
10893231 2000 A family of human RNA-binding proteins related to the Drosophila Bruno translational regulator.