Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.000 1.7e-04
astrocytic glioma -2.100 3.5e-03
Astrocytoma, Pilocytic -2.300 4.4e-07
atypical teratoid / rhabdoid tumor -3.700 3.2e-06
Breast cancer -2.400 1.2e-12
ependymoma -3.400 1.7e-02
glioblastoma -2.900 3.0e-07
group 3 medulloblastoma -3.300 1.3e-04
medulloblastoma, large-cell -4.600 4.3e-08
oligodendroglioma -1.700 1.6e-02
ovarian cancer -1.400 2.2e-05
primitive neuroectodermal tumor -2.100 4.3e-02
psoriasis -1.100 6.7e-13

AA Sequence

MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGR      1 - 70
IYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGM     71 - 140
LNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVK    141 - 210
FADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQI    211 - 280
GAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSP    281 - 350
TVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMF    351 - 420
LPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY         421 - 485
//

Text Mined References (7)

PMID Year Title