Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.100 0.003
posterior fossa group B ependymoma -4.900 0.000
oligodendroglioma -1.900 0.000
glioblastoma -4.300 0.000
group 3 medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -5.300 0.000
primitive neuroectodermal tumor -2.100 0.043
pediatric high grade glioma -3.600 0.000
pilocytic astrocytoma -2.600 0.000
Breast cancer -2.400 0.000
ovarian cancer -1.400 0.000
psoriasis -1.100 0.000

AA Sequence

MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGR      1 - 70
IYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGM     71 - 140
LNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVK    141 - 210
FADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQI    211 - 280
GAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSP    281 - 350
TVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMF    351 - 420
LPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY         421 - 485
//

Text Mined References (7)

PMID Year Title
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
19757395 2010 Differential expression of the Brunol/CELF family genes during Xenopus laevis early development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11158314 2001 The CELF family of RNA binding proteins is implicated in cell-specific and developmentally regulated alternative splicing.
10893231 2000 A family of human RNA-binding proteins related to the Drosophila Bruno translational regulator.