Property Summary

NCBI Gene PubMed Count 12
PubMed Score 179.81
PubTator Score 52.35

Knowledge Summary

Patent (9,059)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.100 3.7e-15
gastric carcinoma 1.400 3.9e-02
group 3 medulloblastoma 1.600 1.9e-02
interstitial cystitis 1.100 4.8e-04
intraductal papillary-mucinous adenoma (... -2.700 3.1e-05
intraductal papillary-mucinous carcinoma... -2.700 4.9e-05
intraductal papillary-mucinous neoplasm ... -1.900 5.4e-03
malignant mesothelioma -1.700 1.7e-05
oligodendroglioma 1.200 9.4e-03
osteosarcoma 1.008 1.9e-03
ovarian cancer 1.100 1.4e-02
Pick disease 1.500 8.0e-06
primitive neuroectodermal tumor 1.200 4.3e-03
psoriasis 1.300 2.0e-04

Gene RIF (6)

AA Sequence

MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLTLSNKFVFSLT      1 - 70
LSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGVIAIDRYYAVLYPMVYPMKIT     71 - 140
GNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVAAWHREPGYTAFWQIWCALFPFLVMLVCYGF    141 - 210
IFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFM    211 - 280
VTWGPYMVVIASEALWGKSSVSPSLETWATWLSFASAVCHPLIYGLWNKTVRKELLGMCFGDRYYREPFV    281 - 350
QRQRTSRLFSISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSH    351 - 420
CTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVT    421 - 490
ARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLAAEQR                                   491 - 529
//

Text Mined References (12)

PMID Year Title