Property Summary

NCBI Gene PubMed Count 93
Grant Count 102
R01 Count 59
Funding $10,673,806.31
PubMed Score 257.83
PubTator Score 130.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.400 0.000
ovarian cancer 1.200 0.000

Synonym

Gene

PDB

3ZG6   3K35   3PKI   3PKJ  

Gene RIF (80)

PMID Text
26787900 demonstrate that PKM2 deacetylation is integral to SIRT6-mediated tumor suppression and inhibition of metastasis. Additionally, reduced SIRT6 levels correlate with elevated nuclear acetylated PKM2 levels in increasing grades of hepatocellular carcinoma
26768768 SIRT6 in a protein complex with both nuclear factor erythroid 2-related factor 2 (NRF2) and RNA polymerase II.
26711340 Results reveal a pathway controlled by ATM, SIRT6, and SNF2H to block HUWE1, which stabilizes H2AX and induces its incorporation into chromatin only when cells are damaged.
26675349 These findings therefore provide insights into the functional interplay between SIRT6 and DNA repair mechanisms, with implications for both tumorigenesis and the treatment of multiple myeloma.
26657850 EGF stimulates loss of FOXO3/SIRT6, which is blockaded by the inhibition of upstream pathways as well as lipid synthesis, revealing existence of a negative regulatory loop between LDs and FOXO3/SIRT6.
26648570 our data suggest that SIRT6 suppresses glioma cell growth via induction of apoptosis, inhibition of oxidative stress and inhibition of the activation of the JAK2/STAT3 signaling pathway.
26639398 These data strongly suggest that overexpression of Sirt6 can prevent osteoarthritis development by reducing both the inflammatory response and chondrocytes senescence.
26549451 Lamin A promotes SIRT6-dependent DNA-PKcs (DNA-PK catalytic subunit) recruitment to chromatin.
26456828 SIRT6 mutations identified in human cancers alter either SIRT6 stability, localization, or enzymatic activity. Deacetylase, not demyristoylase, activity is critical for SIRT6 tumor-suppressor.
26332421 Findings suggest that polymorphisms in SIRT6/UCP1 genes may be important for increased carotid plaque burden and echodensity
More...

AA Sequence

MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGV      1 - 70
WTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEE     71 - 140
CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLS    141 - 210
ITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPR    211 - 280
VLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKA    281 - 350
KAVPS                                                                     351 - 355
//

Text Mined References (98)

PMID Year Title
26787900 2016 SIRT6 deacetylates PKM2 to suppress its nuclear localization and oncogenic functions.
26768768 2016 SIRT6 safeguards human mesenchymal stem cells from oxidative stress by coactivating NRF2.
26711340 2015 ATM and SIRT6/SNF2H Mediate Transient H2AX Stabilization When DSBs Form by Blocking HUWE1 to Allow Efficient ?H2AX Foci Formation.
26675349 2016 Evidence for a role of the histone deacetylase SIRT6 in DNA damage response of multiple myeloma cells.
26657850 2016 Epidermal growth factor receptor mediated proliferation depends on increased lipid droplet density regulated via a negative regulatory loop with FOXO3/Sirtuin6.
26648570 2016 SIRT6 suppresses glioma cell growth via induction of apoptosis, inhibition of oxidative stress and suppression of JAK2/STAT3 signaling pathway activation.
26639398 2015 Overexpression of Sirtuin 6 suppresses cellular senescence and NF-?B mediated inflammatory responses in osteoarthritis development.
26549451 2015 Lamin A Is an Endogenous SIRT6 Activator and Promotes SIRT6-Mediated DNA Repair.
26456828 2015 Identification of and Molecular Basis for SIRT6 Loss-of-Function Point Mutations in Cancer.
26332421 2015 Sirtuin/uncoupling protein gene variants and carotid plaque area and morphology.
More...