Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.50
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.133 0.000
osteosarcoma -1.882 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... 1.100 0.033
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.300 0.000
lung carcinoma 1.200 0.000
non-small cell lung carcinoma 1.100 0.000
pituitary cancer 1.300 0.000

AA Sequence

MEGTAVAVFEILRFLIIHWKCDIDVSKGALLEGQLVISIEGLNSKHQANALHCVTTVASAGSLFGGMVLK      1 - 70
KFLKEIQSILPGISAKLTWTSEEGSYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKV     71 - 140
RFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVRPNFGTIESHCSRIHPVLGHPVMLFIPED    141 - 210
VAGMDLLGELILTPAAALCPSPKVSSNQLNRISSVSIFLYGPLGLPLILSTWEQPMTTFFKDTSSLVDWK    211 - 280
KYHLCMIPNLDLNLDRDLVLPDVSYQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVYTL    281 - 350
LTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKLQASLSVAVNSIMSILTGSTRSSFRKMCLQ    351 - 420
TLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELLADTSGQAEN    421 - 490
KRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLW    491 - 560
LQEVSNLSEWLSPSPGP                                                         561 - 577
//

Text Mined References (8)

PMID Year Title
26917764 2016 The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
18160775 2007 The molecular basis of the folate-sensitive fragile site FRA11A at 11q13.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.