Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.50
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 5.26484984638624E-35
lung carcinoma 2844 1.36618209414664E-21
osteosarcoma 7933 1.30121270173209E-7
pituitary cancer 1972 2.507724371844E-6
pilocytic astrocytoma 3086 3.00179311747173E-6
adult high grade glioma 2148 6.86943351023236E-5
glioblastoma 5572 1.01491714631337E-4
chronic lymphocytic leukemia 244 2.60667853821788E-4
medulloblastoma, large-cell 6234 2.69080326120394E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0329331898021292
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
chronic lymphocytic leukemia 1.133 0.000
osteosarcoma -1.882 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... 1.100 0.033
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.300 0.000
lung carcinoma 1.200 0.000
non-small cell lung carcinoma 1.100 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q8N6T0 Q9H677
Symbols TOP6BL
TOPOVIBL

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG

AA Sequence

MEGTAVAVFEILRFLIIHWKCDIDVSKGALLEGQLVISIEGLNSKHQANALHCVTTVASAGSLFGGMVLK      1 - 70
KFLKEIQSILPGISAKLTWTSEEGSYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKV     71 - 140
RFHFSVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVRPNFGTIESHCSRIHPVLGHPVMLFIPED    141 - 210
VAGMDLLGELILTPAAALCPSPKVSSNQLNRISSVSIFLYGPLGLPLILSTWEQPMTTFFKDTSSLVDWK    211 - 280
KYHLCMIPNLDLNLDRDLVLPDVSYQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVYTL    281 - 350
LTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKLQASLSVAVNSIMSILTGSTRSSFRKMCLQ    351 - 420
TLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELLADTSGQAEN    421 - 490
KRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLW    491 - 560
LQEVSNLSEWLSPSPGP                                                         561 - 577
//

Text Mined References (8)

PMID Year Title
26917764 2016 The TopoVIB-Like protein family is required for meiotic DNA double-strand break formation.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
18160775 2007 The molecular basis of the folate-sensitive fragile site FRA11A at 11q13.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.