Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.79
PubTator Score 3.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 4.36127146050879E-25
posterior fossa group A ependymoma 1511 9.35628548073352E-9
atypical teratoid/rhabdoid tumor 1095 1.60447079591023E-8
pediatric high grade glioma 2712 1.6538937411667E-7
sonic hedgehog group medulloblastoma 1482 1.71894044028437E-6
primitive neuroectodermal tumor 3031 1.80676037882389E-6
medulloblastoma, large-cell 6234 5.052447582579E-6
glioblastoma 5572 1.2424833762075E-5
pilocytic astrocytoma 3086 1.35035236033089E-5
nasopharyngeal carcinoma 1056 2.59505001151161E-5
osteosarcoma 7933 9.81498889656586E-5
ovarian cancer 8492 8.20242003435961E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00157248644963786
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00291209273794939
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00946362945659706
oligodendroglioma 2849 0.0173531615759277
Rheumatoid Arthritis 1171 0.0420905240341745

Expression

Synonym

Accession Q8N6S5 B2RDS6 Q7Z4G7 ARL-6-interacting protein 6
Symbols AIP6
AIP-6
PFAAP1

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
25957586 ARL6IP6 as a novel candidate gene for a syndromic form of CMTC.

AA Sequence

MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKR      1 - 70
SVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENL     71 - 140
KNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMA    141 - 210
ILNGIVAALTVAWCLM                                                          211 - 226
//

Text Mined References (13)

PMID Year Title
25957586 2015 ARL6IP6, a susceptibility locus for ischemic stroke, is mutated in a patient with syndromic Cutis Marmorata Telangiectatica Congenita.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...