Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.79
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q8N6S5 B2RDS6 Q7Z4G7 ARL-6-interacting protein 6
Symbols AIP6
AIP-6
PFAAP1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKR      1 - 70
SVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENL     71 - 140
KNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMA    141 - 210
ILNGIVAALTVAWCLM                                                          211 - 226
//

Text Mined References (13)

PMID Year Title