Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.76
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.500 2.0e-03
astrocytic glioma -1.100 2.3e-02
atypical teratoid / rhabdoid tumor -1.100 3.4e-03
glioblastoma -1.100 7.2e-04
intraductal papillary-mucinous neoplasm ... 1.200 6.1e-03
medulloblastoma -1.100 1.2e-03
medulloblastoma, large-cell -1.200 8.3e-04
oligodendroglioma -1.300 3.3e-02
osteosarcoma -1.234 1.2e-02
ovarian cancer -1.200 5.6e-05
Pick disease -1.200 1.3e-04
primitive neuroectodermal tumor -1.100 2.6e-03
subependymal giant cell astrocytoma -1.191 3.0e-02

Gene RIF (3)

AA Sequence

MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHRLQLKAAPASS      1 - 70
NPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECVFKGDVRRLSSLIRTHNIGQK     71 - 140
DNHGNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLRKLKQQSRESVEE    141 - 210
KRPRLLKALKELGDFYLELHWDFQSWVPLLSRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFI    211 - 280
FNGDAAPSESFVVLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDK    281 - 350
TERVGNFLADFYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTI    351 - 420
TWEEYISAENGKAPHLGRELVCKESKKTFKATIAMSQEFPLGIELLLNVLEVVAPFKHFNKLREFVQMKL    421 - 490
PPGFPVKLDIPVFPTITATVTFQEFRYDEFDGSIFTIPDDYKEDPSRFPDL                       491 - 541
//

Text Mined References (11)

PMID Year Title