Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.76
PubTator Score 1.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.100 0.023
oligodendroglioma -1.400 0.013
osteosarcoma -1.234 0.012
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.100 0.001
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.003
intraductal papillary-mucinous neoplasm ... 1.200 0.006
adult high grade glioma -1.500 0.002
subependymal giant cell astrocytoma -1.191 0.030
Pick disease -1.200 0.000
ovarian cancer 1.400 0.006

Synonym

Accession Q8N6S4 B3KQ97 Q5VYH4 Q5VYH5 Q6PJE4 Q9H0N9
Symbols dJ677H15.3

Gene

Gene RIF (3)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ANKRD13C gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ANKRD13C
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ANKRD13C gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ANKRD13C
20959461 ANKRD13C acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.

AA Sequence

MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHRLQLKAAPASS      1 - 70
NPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECVFKGDVRRLSSLIRTHNIGQK     71 - 140
DNHGNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLRKLKQQSRESVEE    141 - 210
KRPRLLKALKELGDFYLELHWDFQSWVPLLSRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFI    211 - 280
FNGDAAPSESFVVLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDK    281 - 350
TERVGNFLADFYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTI    351 - 420
TWEEYISAENGKAPHLGRELVCKESKKTFKATIAMSQEFPLGIELLLNVLEVVAPFKHFNKLREFVQMKL    421 - 490
PPGFPVKLDIPVFPTITATVTFQEFRYDEFDGSIFTIPDDYKEDPSRFPDL                       491 - 541
//

Text Mined References (11)

PMID Year Title
20959461 2010 ANKRD13C acts as a molecular chaperone for G protein-coupled receptors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...