Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.76
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.13816864405394E-5
atypical teratoid / rhabdoid tumor 4369 4.24911792133004E-5
glioblastoma 5572 4.80142065479234E-5
Pick disease 1893 1.29253442626896E-4
medulloblastoma 1524 0.00118829207123026
adult high grade glioma 2148 0.00204505494318782
primitive neuroectodermal tumor 3031 0.00255546146660873
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0061483167656532
ovarian cancer 8492 0.00618567014493168
osteosarcoma 7933 0.012164039053822
oligodendroglioma 2849 0.0132294820780325
astrocytic glioma 2241 0.0231187174746659
subependymal giant cell astrocytoma 2287 0.0304883624963961

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.100 0.023
oligodendroglioma -1.400 0.013
osteosarcoma -1.234 0.012
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.100 0.001
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.003
intraductal papillary-mucinous neoplasm ... 1.200 0.006
adult high grade glioma -1.500 0.002
subependymal giant cell astrocytoma -1.191 0.030
Pick disease -1.200 0.000
ovarian cancer 1.400 0.006

Synonym

Accession Q8N6S4 B3KQ97 Q5VYH4 Q5VYH5 Q6PJE4 Q9H0N9
Symbols dJ677H15.3

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ANKRD13C gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ANKRD13C
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ANKRD13C gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ANKRD13C
20959461 ANKRD13C acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.

AA Sequence

MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHRLQLKAAPASS      1 - 70
NPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECVFKGDVRRLSSLIRTHNIGQK     71 - 140
DNHGNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLRKLKQQSRESVEE    141 - 210
KRPRLLKALKELGDFYLELHWDFQSWVPLLSRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFI    211 - 280
FNGDAAPSESFVVLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDK    281 - 350
TERVGNFLADFYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTI    351 - 420
TWEEYISAENGKAPHLGRELVCKESKKTFKATIAMSQEFPLGIELLLNVLEVVAPFKHFNKLREFVQMKL    421 - 490
PPGFPVKLDIPVFPTITATVTFQEFRYDEFDGSIFTIPDDYKEDPSRFPDL                       491 - 541
//

Text Mined References (11)

PMID Year Title
20959461 2010 ANKRD13C acts as a molecular chaperone for G protein-coupled receptors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...