Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.52
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 1.6e-03
astrocytic glioma -1.200 1.6e-02
atypical teratoid / rhabdoid tumor -1.700 3.4e-07
ependymoma -1.700 2.7e-02
glioblastoma -1.400 8.8e-07
group 3 medulloblastoma -2.500 1.0e-05
medulloblastoma, large-cell -2.400 7.6e-04
subependymal giant cell astrocytoma -1.539 2.4e-02

AA Sequence

MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM           1 - 65
//

Text Mined References (7)

PMID Year Title