Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.85
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.36035654155996E-7
pediatric high grade glioma 2712 1.99993233459266E-6
glioblastoma 5572 6.87335464450311E-6
group 3 medulloblastoma 2254 1.01354700803553E-5
medulloblastoma, large-cell 6234 7.5881916748598E-4
astrocytic glioma 2241 0.0159827427039595
subependymal giant cell astrocytoma 2287 0.0244758310577466
ependymoma 2514 0.026939111476649

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 0.016
ependymoma -1.700 0.027
glioblastoma -1.900 0.000
group 3 medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.400 0.001
pediatric high grade glioma -1.700 0.000
subependymal giant cell astrocytoma -1.539 0.024

Synonym

Accession Q8N6R1
Symbols C13orf21
bA269C23.1

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM           1 - 65
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.