Property Summary

NCBI Gene PubMed Count 13
PubMed Score 39.65
PubTator Score 5.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 2.00491911833725E-5
hepatocellular carcinoma 550 4.82872621147942E-5
medulloblastoma, large-cell 6234 9.79629528540095E-5
lung cancer 4473 2.98383272735367E-4
osteosarcoma 7933 3.29865659073699E-4
diabetes mellitus 1663 0.00111699861784687
ovarian cancer 8492 0.00339378123777994
acute myeloid leukemia 785 0.00567618490906407
pancreatic cancer 2300 0.00816891182996744
pancreatic carcinoma 567 0.00816891182996748
gastric cancer 436 0.0100745246413771
colon cancer 1475 0.0442550124018876

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.400 0.010
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 1.700 0.008
osteosarcoma -1.354 0.000
medulloblastoma, large-cell 1.200 0.000
tuberculosis and treatment for 6 months -1.800 0.000
colon cancer 1.500 0.044
lung cancer 2.000 0.000
diabetes mellitus 1.300 0.001
pancreatic carcinoma 1.700 0.008
acute myeloid leukemia -1.500 0.006
ovarian cancer 1.300 0.003

Synonym

Accession Q8N6R0 A6NFK0 A8K6S5 O94940 Q53EZ6 Q5TGP9 Q5TGQ0 Q8N2P8 Q96J11 Q96SQ0 Q9Y2Z1 Q9Y3M6
Symbols feat
CGI-01
KIAA0859
5630401D24Rik

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MNLLPKSSREFGSVDYWEKFFQQRGKKAFEWYGTYLELCGVLHKYIKPREKVLVIGCGNSELSEQLYDVG      1 - 70
YRDIVNIDISEVVIKQMKECNATRRPQMSFLKMDMTQMEFPDASFQVVLDKGTLDAVLTDEEEKTLQQVD     71 - 140
RMLAEVGRVLQVGGRYLCISLAQAHILKKAVGHFSREGWMVRVHQVANSQDQVLEAEPQFSLPVFAFIMT    141 - 210
KFRPVPGSALQIFELCAQEQRKPVRLESAERLAEAVQERQQYAWLCSQLRRKARLGSVSLDLCDGDTGEP    211 - 280
RYTLHVVDSPTVKPSRDNHFAIFIIPQGRETEWLFGMDEGRKQLAASAGFRRLITVALHRGQQYESMDHI    281 - 350
QAELSARVMELAPAGMPTQQQVPFLSVGGDIGVRTVQHQDCSPLSGDYVIEDVQGDDKRYFRRLIFLSNR    351 - 420
NVVQSEARLLKDVSHKAQKKRKKDRKKQRPADAEDLPAAPGQSIDKSYLCCEHHKAMIAGLALLRNPELL    421 - 490
LEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLA    491 - 560
GGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGL    561 - 630
KAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV     631 - 699
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22355534 2011 A novel potent tumour promoter aberrantly overexpressed in most human cancers.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...