Property Summary

NCBI Gene PubMed Count 14
PubMed Score 43.76
PubTator Score 5.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.500 5.7e-03
colon cancer 1.500 4.4e-02
diabetes mellitus 1.300 1.1e-03
gastric cancer 1.100 5.8e-03
hepatocellular carcinoma 1.300 4.0e-05
lung cancer 1.900 3.1e-04
medulloblastoma, large-cell 1.200 9.8e-05
osteosarcoma -1.354 3.3e-04
ovarian cancer 1.100 1.6e-05
pancreatic cancer 1.300 4.3e-03
pancreatic carcinoma 1.300 4.3e-03
tuberculosis and treatment for 3 months -1.100 3.5e-03

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MNLLPKSSREFGSVDYWEKFFQQRGKKAFEWYGTYLELCGVLHKYIKPREKVLVIGCGNSELSEQLYDVG      1 - 70
YRDIVNIDISEVVIKQMKECNATRRPQMSFLKMDMTQMEFPDASFQVVLDKGTLDAVLTDEEEKTLQQVD     71 - 140
RMLAEVGRVLQVGGRYLCISLAQAHILKKAVGHFSREGWMVRVHQVANSQDQVLEAEPQFSLPVFAFIMT    141 - 210
KFRPVPGSALQIFELCAQEQRKPVRLESAERLAEAVQERQQYAWLCSQLRRKARLGSVSLDLCDGDTGEP    211 - 280
RYTLHVVDSPTVKPSRDNHFAIFIIPQGRETEWLFGMDEGRKQLAASAGFRRLITVALHRGQQYESMDHI    281 - 350
QAELSARVMELAPAGMPTQQQVPFLSVGGDIGVRTVQHQDCSPLSGDYVIEDVQGDDKRYFRRLIFLSNR    351 - 420
NVVQSEARLLKDVSHKAQKKRKKDRKKQRPADAEDLPAAPGQSIDKSYLCCEHHKAMIAGLALLRNPELL    421 - 490
LEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLA    491 - 560
GGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGL    561 - 630
KAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV     631 - 699
//

Text Mined References (20)

PMID Year Title