Property Summary

NCBI Gene PubMed Count 13
Grant Count 10
R01 Count 2
Funding $3,215,364
PubMed Score 39.65
PubTator Score 5.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.400 0.010
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 1.700 0.008
osteosarcoma -1.354 0.000
medulloblastoma, large-cell 1.200 0.000
tuberculosis and treatment for 6 months -1.800 0.000
colon cancer 1.500 0.044
lung cancer 2.000 0.000
diabetes mellitus 1.300 0.001
pancreatic carcinoma 1.700 0.008
acute myeloid leukemia -1.500 0.006
ovarian cancer 1.300 0.003

AA Sequence

MNLLPKSSREFGSVDYWEKFFQQRGKKAFEWYGTYLELCGVLHKYIKPREKVLVIGCGNSELSEQLYDVG      1 - 70
YRDIVNIDISEVVIKQMKECNATRRPQMSFLKMDMTQMEFPDASFQVVLDKGTLDAVLTDEEEKTLQQVD     71 - 140
RMLAEVGRVLQVGGRYLCISLAQAHILKKAVGHFSREGWMVRVHQVANSQDQVLEAEPQFSLPVFAFIMT    141 - 210
KFRPVPGSALQIFELCAQEQRKPVRLESAERLAEAVQERQQYAWLCSQLRRKARLGSVSLDLCDGDTGEP    211 - 280
RYTLHVVDSPTVKPSRDNHFAIFIIPQGRETEWLFGMDEGRKQLAASAGFRRLITVALHRGQQYESMDHI    281 - 350
QAELSARVMELAPAGMPTQQQVPFLSVGGDIGVRTVQHQDCSPLSGDYVIEDVQGDDKRYFRRLIFLSNR    351 - 420
NVVQSEARLLKDVSHKAQKKRKKDRKKQRPADAEDLPAAPGQSIDKSYLCCEHHKAMIAGLALLRNPELL    421 - 490
LEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLA    491 - 560
GGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGL    561 - 630
KAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV     631 - 699
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22355534 2011 A novel potent tumour promoter aberrantly overexpressed in most human cancers.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...