Property Summary

NCBI Gene PubMed Count 77
PubMed Score 305.98
PubTator Score 497.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -2.988 2.6e-02
colon cancer -4.500 5.0e-11
malignant mesothelioma -1.100 5.2e-05
mucosa-associated lymphoid tissue lympho... 2.434 2.8e-02
osteosarcoma -2.856 3.9e-04
periodontitis 1.100 2.2e-12
psoriasis 3.600 1.4e-59

Gene RIF (38)

AA Sequence

MSAVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSL      1 - 70
VLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME     71 - 140
GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLT    141 - 210
CHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHS    211 - 280
APPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATH    281 - 350
CYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGGGAEGLESLTWGV    351 - 420
GLALAPALWWGVVCPSC                                                         421 - 437
//

Text Mined References (77)

PMID Year Title