Property Summary

NCBI Gene PubMed Count 68
Grant Count 22
R01 Count 6
Funding $12,739,734.8
PubMed Score 290.08
PubTator Score 497.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
osteosarcoma -2.856 0.000
periodontitis 1.100 0.000
colon cancer -4.500 0.000
active ulcerative colitis -2.988 0.026
mucosa-associated lymphoid tissue lympho... 2.434 0.028
psoriasis 3.600 0.000

Gene RIF (34)

PMID Text
26829180 Data indicate that high percentage of CD177 antigen-positive neutrophils undergo dynamic change during sepsis.
26024230 the CD177 SNP is the primary genetic determinant for HNA-2 deficiency and expression variations. The mechanistic delineation of HNA-2 genetics will enable the development of genetic tests for diagnosis and prognosis of HNA-2-related human diseases.
24124144 Skewed low neutrophil CD177(%) is highly associated with clonal myeloid disorders, particularly myelodysplasia, and may be useful for detecting clonal myeloid disorders.
23899160 This is the first report showing a prognostic correlation between CD177 expression and solid tumor behavior.
22690867 CD177/PECAM-1 adhesive interaction, while contributing to neutrophil-endothelial cell interaction in neutrophil transendothelial migration, does not contribute to or is redundant in platelet-neutrophil interactions
22300941 PRV1 overexpression is associated with Essential Thrombocythemia and Myelofibrosis.
22266279 NB1-proteinase 3 interactions may play a role in aiding neutrophil transmigration.
21193407 pivotal role of the NB1-Mac-1 receptor interaction for PR3-ANCA-mediated neutrophil activation
20491791 The increased membrane expression of PR3 found in ANCA-associated systemic vasculitis is not linked directly to circulating PR3 or PR3 gene transcription, but is dependent upon CD177 expression and correlated with the transcription of the CD177 gene.
20194726 heterophilic PECAM-1/CD177 interactions affect the phosphorylation state of PECAM-1 and endothelial cell junctional integrity in such a way as to facilitate neutrophil transmigration in a previously unrecognized allele-specific manner.
More...

AA Sequence

MSAVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSL      1 - 70
VLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSME     71 - 140
GCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLT    141 - 210
CHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHS    211 - 280
APPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATH    281 - 350
CYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGGGAEGLESLTWGV    351 - 420
GLALAPALWWGVVCPSC                                                         421 - 437
//

Text Mined References (68)

PMID Year Title
26829180 2015 CD177/NB1 receptor expression is dynamically regulated in sepsis patients.
26024230 2015 Genetic mechanism of human neutrophil antigen 2 deficiency and expression variations.
25416956 2014 A proteome-scale map of the human interactome network.
24597828 2014 Relevance of novel inflammatory markers in stroke-induced immunosuppression.
24124144 2013 CD177 expression on neutrophils: in search of a clonal assay for myeloid neoplasia by flow cytometry.
23907354 2014 Effects of a combined treatment with tamoxifen and estrogen receptor ? agonists on human breast cancer cell lines.
23899160 2013 Gene expression analysis of a Helicobacter pylori-infected and high-salt diet-treated mouse gastric tumor model: identification of CD177 as a novel prognostic factor in patients with gastric cancer.
23822853 2013 IL-17-producing peripheral blood CD177+ neutrophils increase in allergic asthmatic subjects.
23706337 2013 Changes in the seminal plasma proteome of adolescents before and after varicocelectomy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...