Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $39,217.67
PubMed Score 0.33
PubTator Score 0.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Gene RIF (2)

PMID Text
21577013 Longer survival was associated with hypomethylation at specific CpG sites (e.g. GREB1, TGIF and TOB1) and hypermethylation in other genes (e.g. TMCO5, PTPRN and GUCY2C).
19679847 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEISRLAQSKRNIISLNMDLERDTQRIDEANQKLLLKIQEREDKIQRLESEIIQTRGLVEDEEWEKENRT      1 - 70
TMERERALQELEEETARLERKNKTLVHSITELQQKLTRKSQKITNCEQSSPDGALEETKVKLQQLEASYA     71 - 140
CQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVEKEHTSQNNEG    141 - 210
TPTQKTARLFSKKIFCCLFFITLFFIRLLSYMFFHVRFINPDLLVNVLPKVLGRSTLWKLRCFFFPSLTL    211 - 280
ETEDMLPH                                                                  281 - 288
//

Text Mined References (5)

PMID Year Title
21577013 2011 Progression-free survival in ovarian cancer is reflected in epigenetic DNA methylation profiles.
19679847 2009 Multi-ethnic genetic association study of carotid intima-media thickness using a targeted cardiovascular SNP microarray.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.