Property Summary

NCBI Gene PubMed Count 29
Grant Count 15
R01 Count 6
Funding $879,015.48
PubMed Score 51.33
PubTator Score 44.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (24)

PMID Text
26171402 FBXW12 functions as an E3 ligase constituent to ubiquitinate and degrade IL-22R and that therapeutic FBXW12 inhibition may enhance IL-22 signaling and bolster mucosal host defense and infection containment.
25880879 IL-22R1 is over-expressed in primary Sjogren's syndrome and Sjogren-associated non-Hodgkin lymphomas and is regulated by IL-18.
24856143 IL-22 has restricted tissue specificity as its unique receptor IL-22R1 is exclusively expressed on epithelial and tissue cells, but not immune cells.
24132627 High expression of interleukin-22 receptor is associated with pancreatic ductal adenocarcinoma.
23688404 Letter: calcipotriol inhibits the IL-22-induced epidermal hyperplasia by decreasing keratinocyte proliferation and down-modulating IL-22R expression.
23659670 the CC genotype of rs3795299 polymorphism in the IL-22R1 gene is associated with the reduced risk of IgAN, and this genetic association was supported by the higher renal expression of IL-22R1 in healthy controls compared with patients with IgAN.
23512698 serum IL-22 levels are significantly higher in patients with pituitary macroadenomas than in healthy controls and IL-22R is variably expressed in both prolactinoma and non-functioing pituitary adenoma cells.
22898922 Data show that IL-17RA, IL-17RC, IL-22R1, ERK1/2 MAPK and NF-kappaB pathways are involved in Th17 cytokine-induced proliferation.
21690049 IL-22R1 mRNA and protein expressions in HASMCs were significantly increased after stimulation by serum from asthmatic patients, but decreased after co-stimulation with dexamethasone.
20971950 This study documents a previously unknown role of IL-22R1 in inflammation and identifies the involvement of IL-22R1/IL-22 in anaplastic lymphoma kinase-positive anaplastic large cell lymphoma
More...

AA Sequence

MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKG      1 - 70
CQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVH     71 - 140
PTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAK    141 - 210
ESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQE    211 - 280
HVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLS    281 - 350
YAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLS    351 - 420
SPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQ    421 - 490
YLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELD    491 - 560
SLFRGLALTVQWES                                                            561 - 574
//

Text Mined References (42)

PMID Year Title
26171402 2015 The Human IL-22 Receptor Is Regulated through the Action of the Novel E3 Ligase Subunit FBXW12, Which Functions as an Epithelial Growth Suppressor.
25880879 2015 Interleukin (IL)-22 receptor 1 is over-expressed in primary Sjogren's syndrome and Sjögren-associated non-Hodgkin lymphomas and is regulated by IL-18.
24856143 2014 The role of the IL-22/IL-22R1 axis in cancer.
24132627 2014 High expression of interleukin-22 and its receptor predicts poor prognosis in pancreatic ductal adenocarcinoma.
23688404 2013 Calcipotriol modulates IL-22 receptor expression and keratinocyte proliferation in IL-22-induced epidermal hyperplasia.
23659670 2013 A polymorphism of interleukin-22 receptor alpha-1 is associated with the development of childhood IgA nephropathy.
23512698 2014 Increased serum interleukin-22 levels in patients with PRL-secreting and non-functioning pituitary macroadenomas.
22898922 2012 Th17-associated cytokines promote human airway smooth muscle cell proliferation.
21690049 2011 [Change of IL-22R1 expression in human airway smooth muscle cells in response to different stimulating agents].
20971950 2011 A novel role for IL-22R1 as a driver of inflammation.
More...