Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.74
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Narcolepsy 69 3.338 1.7

Expression

Synonym

Accession Q8N6N7 A6NCI2 B3KTG8
Symbols bA455B2.2

Gene

PANTHER Protein Class (1)

PDB

3EPY  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 Compartment GO Term (2)

AA Sequence

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED      1 - 70
ATSAYISKAKELIEKYGI                                                         71 - 88
//

Text Mined References (5)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.