Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.01
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Narcolepsy 72 3.12 1.6

Expression

Synonym

Accession Q8N6N7 A6NCI2 B3KTG8
Symbols bA455B2.2

Gene

PANTHER Protein Class (1)

PDB

3EPY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED      1 - 70
ATSAYISKAKELIEKYGI                                                         71 - 88
//

Text Mined References (5)

PMID Year Title