Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $155,000
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.800 0.007
ependymoma -1.700 0.018
oligodendroglioma -1.500 0.015
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.200 0.003
juvenile dermatomyositis 1.037 0.000
primary pancreatic ductal adenocarcinoma 1.183 0.002
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.800 0.000
subependymal giant cell astrocytoma -1.515 0.012
Pick disease -1.300 0.000
ovarian cancer 1.500 0.001

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAEEKDPLSYFAAYGSSSSGSSDEEDNIEPEETSRRTPDPAKSAGGCRNKAEKRLPGPDELFRSVTRPA      1 - 70
FLYNPLNKQIDWERHVVKAPEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAP     71 - 140
QNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKKK                                141 - 182
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...