Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.200 3.5e-05
astrocytic glioma -1.400 6.2e-03
Astrocytoma, Pilocytic -1.400 1.7e-05
atypical teratoid / rhabdoid tumor -3.300 1.1e-13
ependymoma -1.900 1.1e-02
glioblastoma -2.100 7.3e-06
group 3 medulloblastoma -2.700 2.8e-05
medulloblastoma, large-cell -3.300 3.4e-07
oligodendroglioma -1.400 2.8e-17
primitive neuroectodermal tumor -1.100 3.5e-02
subependymal giant cell astrocytoma -1.984 1.6e-02

Gene RIF (2)

AA Sequence

MQRGALSPVLMLSAAPEPPPRPPPALSPPGSGPGSGSRHGSARPGPTPEPSGSLGAALDSSLRAAVAFKA      1 - 70
EGQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPARLSEEQRRLVESTEVECYDS     71 - 140
LTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRY    141 - 210
IQLTQLKMNRCSLQREDSGAGSQTRDVIG                                             211 - 239
//

Text Mined References (6)

PMID Year Title