Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
24317310 found two biomarker loci at HP1BP3 and TTC9B, which predicted postpartum depression

AA Sequence

MQRGALSPVLMLSAAPEPPPRPPPALSPPGSGPGSGSRHGSARPGPTPEPSGSLGAALDSSLRAAVAFKA      1 - 70
EGQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPARLSEEQRRLVESTEVECYDS     71 - 140
LTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRY    141 - 210
IQLTQLKMNRCSLQREDSGAGSQTRDVIG                                             211 - 239
//

Text Mined References (5)

PMID Year Title
24317310 2014 Seeing the future: epigenetic biomarkers of postpartum depression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.