Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.62
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.18480431307662E-7
medulloblastoma, large-cell 6234 1.2838313672631E-5
Pick disease 1893 3.89670494208905E-5
medulloblastoma 1524 1.22252180217076E-4
ovarian cancer 8492 4.84008605016783E-4
ulcerative colitis 2087 0.00102179118500221
non primary Sjogren syndrome sicca 840 0.0124272228173805
primary pancreatic ductal adenocarcinoma 1271 0.015930922515227
pancreatic cancer 2300 0.0224761759223424
astrocytic glioma 2241 0.0272190023144543
acute myeloid leukemia 785 0.0334875786334686
ependymoma 2514 0.0397639647707473

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.300 0.027
ependymoma -1.400 0.040
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -2.300 0.000
primary pancreatic ductal adenocarcinoma 1.304 0.016
non primary Sjogren syndrome sicca 1.500 0.012
Pick disease -1.400 0.000
acute myeloid leukemia 1.100 0.033
ulcerative colitis 1.200 0.001
ovarian cancer 1.300 0.000
pancreatic cancer 1.100 0.022

Synonym

Accession Q8N6M9 A4D220
Symbols AIRAP

Gene

  Ortholog (6)

Gene RIF (3)

PMID Text
24898249 arsenite- inducible regulatory particle-associated protein (AIRAP) transcript to be translationally induced during arsenite stress conditions.
24619424 Data indicate that both heat shock factors HSF1 and HSF2 are recruited to the arsenite-inducible RNA-associated protein (AIRAP) promoter and regulate bortezomib-induced AIRAP expression.
20185824 The HSF1 binding HSE sequence in the AIRAP promoter critical for heat-induced transcription was identified.

AA Sequence

MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQ      1 - 70
IPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRP     71 - 140
TIKAG                                                                     141 - 145
//

Text Mined References (6)

PMID Year Title
24898249 2014 Stress-induced start codon fidelity regulates arsenite-inducible regulatory particle-associated protein (AIRAP) translation.
24619424 2014 The proteasome inhibitor bortezomib is a potent inducer of zinc finger AN1-type domain 2a gene expression: role of heat shock factor 1 (HSF1)-heat shock factor 2 (HSF2) heterocomplexes.
20185824 2010 AIRAP, a new human heat shock gene regulated by heat shock factor 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.