Property Summary

NCBI Gene PubMed Count 5
Grant Count 23
R01 Count 16
Funding $3,603,472
PubMed Score 7.62
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.300 0.027
ependymoma -1.400 0.040
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -2.300 0.000
primary pancreatic ductal adenocarcinoma 1.304 0.016
non primary Sjogren syndrome sicca 1.500 0.012
Pick disease -1.400 0.000
acute myeloid leukemia 1.100 0.033
ulcerative colitis 1.200 0.001
ovarian cancer 1.300 0.000
pancreatic cancer 1.100 0.022

Gene RIF (3)

PMID Text
24898249 arsenite- inducible regulatory particle-associated protein (AIRAP) transcript to be translationally induced during arsenite stress conditions.
24619424 Data indicate that both heat shock factors HSF1 and HSF2 are recruited to the arsenite-inducible RNA-associated protein (AIRAP) promoter and regulate bortezomib-induced AIRAP expression.
20185824 The HSF1 binding HSE sequence in the AIRAP promoter critical for heat-induced transcription was identified.

AA Sequence

MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQ      1 - 70
IPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRP     71 - 140
TIKAG                                                                     141 - 145
//

Text Mined References (6)

PMID Year Title
24898249 2014 Stress-induced start codon fidelity regulates arsenite-inducible regulatory particle-associated protein (AIRAP) translation.
24619424 2014 The proteasome inhibitor bortezomib is a potent inducer of zinc finger AN1-type domain 2a gene expression: role of heat shock factor 1 (HSF1)-heat shock factor 2 (HSF2) heterocomplexes.
20185824 2010 AIRAP, a new human heat shock gene regulated by heat shock factor 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.