Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.62
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.100 3.3e-02
astrocytic glioma -1.300 2.7e-02
atypical teratoid / rhabdoid tumor -1.700 1.2e-07
ependymoma -1.400 4.0e-02
group 4 medulloblastoma -1.100 2.4e-03
medulloblastoma, large-cell -2.300 1.3e-05
non primary Sjogren syndrome sicca 1.500 1.2e-02
ovarian cancer -1.100 2.3e-04
pancreatic cancer 1.100 2.2e-02
Pick disease -1.400 3.9e-05
primary pancreatic ductal adenocarcinoma 1.304 1.6e-02
ulcerative colitis 1.200 1.0e-03

Gene RIF (3)

AA Sequence

MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLCNTPIPVKKGQ      1 - 70
IPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRP     71 - 140
TIKAG                                                                     141 - 145
//

Text Mined References (6)

PMID Year Title