Property Summary

NCBI Gene PubMed Count 8
Grant Count 123
R01 Count 74
Funding $25,392,300.15
PubMed Score 676.46
PubTator Score 228.45

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N6M5 Q53T95 Q5RL81 Q96RE6 Q9NZA7
Symbols ALC

Gene

AA Sequence

MADAPKEGRLTRFLDFTQLMDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWET      1 - 70
RRKRIPGHDWCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEEF     71 - 140
EAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTATD    141 - 210
PKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEW    211 - 280
AVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEEAVIRQKWILPAHKWKPLLPVTKLSPNQS    281 - 350
HLFDSLTLELQDVITHARLTIVPDGGVSRLRLRGFPSSICLLRPREKPMLKFSVSFKANP              351 - 410
//

Text Mined References (8)

PMID Year Title
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036579 2002 Genomic organization and chromosome localization of the murine and human allantoicase gene.
11054555 2000 Human allantoicase gene: cDNA cloning, genomic organization and chromosome localization.