Property Summary

NCBI Gene PubMed Count 8
PubMed Score 709.65
PubTator Score 228.45

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N6M5 Q53T95 Q5RL81 Q96RE6 Q9NZA7
Symbols ALC

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MADAPKEGRLTRFLDFTQLMDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWET      1 - 70
RRKRIPGHDWCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEEF     71 - 140
EAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFGTGQKDWTATD    141 - 210
PKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEW    211 - 280
AVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEEAVIRQKWILPAHKWKPLLPVTKLSPNQS    281 - 350
HLFDSLTLELQDVITHARLTIVPDGGVSRLRLRGFPSSICLLRPREKPMLKFSVSFKANP              351 - 410
//

Text Mined References (8)

PMID Year Title