Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 2.7e-02
juvenile dermatomyositis 1.048 1.1e-07
sarcoidosis 1.200 7.8e-03

Gene RIF (4)

AA Sequence

MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQL      1 - 70
KLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQ     71 - 140
ILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPE    141 - 210
EFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNS    211 - 280
VTRLVNIVTENCS                                                             281 - 293
//

Text Mined References (15)

PMID Year Title