Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.048 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.027
sarcoidosis 1.200 0.008

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human OTU domain containing 6B (OTUD6B) at amino acid residues 5-6 by the HIV-1 protease
21267069 down-regulation of Otud-6b expression after prolonged cytokine stimulation may be required for cell proliferation in B lymphocytes

AA Sequence

MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQL      1 - 70
KLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQ     71 - 140
ILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPE    141 - 210
EFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNS    211 - 280
VTRLVNIVTENCS                                                             281 - 293
//

Text Mined References (13)

PMID Year Title
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21267069 2011 Evidence for OTUD-6B participation in B lymphocytes cell cycle after cytokine stimulation.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...