Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.06
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
active Crohn's disease 918
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.097 0.015
psoriasis -1.400 0.000

AA Sequence

MQNRTGLILCALALLMGFLMVCLGAFFISWGSIFDCQGSLIAAYLLLPLGFVILLSGIFWSNYRQVTESK      1 - 70
GVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAEREASGIPPPLYTETGLEFQDGNDSH     71 - 140
PEAPPSYRESIAGLVVTAISEDAQRRGQEC                                            141 - 170
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.