Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.06
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.4e-38
active Crohn's disease 922 1.5e-02

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.097 1.5e-02
psoriasis -1.400 2.4e-38

AA Sequence

MQNRTGLILCALALLMGFLMVCLGAFFISWGSIFDCQGSLIAAYLLLPLGFVILLSGIFWSNYRQVTESK      1 - 70
GVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAEREASGIPPPLYTETGLEFQDGNDSH     71 - 140
PEAPPSYRESIAGLVVTAISEDAQRRGQEC                                            141 - 170
//

Text Mined References (3)

PMID Year Title