Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.41
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-08
Disease Target Count Z-score Confidence
Gout 104 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.021 1.6e-08

Gene RIF (2)

AA Sequence

MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAK      1 - 70
IFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN         71 - 136
//

Text Mined References (15)

PMID Year Title