Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.67
PubTator Score 0.80

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.72988186396838E-11


  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.300 0.000


PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid

 Compartment GO Term (0)

Gene RIF (2)

20978832 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20602751 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LETLIFDMHSPYFPSLKEKENEVGFQHPLT                                            491 - 520

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
20978832 2011 Gene-environment interaction in the etiology of mathematical ability using SNP sets.
20602751 2010 Generalist genes analysis of DNA markers associated with mathematical ability and disability reveals shared influence across ages and abilities.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).