Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.97
PubTator Score 0.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.7e-11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.300 2.7e-11

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

METWSVEQVCSWLVEKNLGELVHRFQEEEVSGAALLALNDRMVQQLVKKIGHQAVLMDLIKKYKQNTQGL      1 - 70
KSPENPKKAALVMQTEAARDYRDEESSSPARHGEQMPSFYPAENLDNGLIDQRVLKQRRNVKQILARSKA     71 - 140
LQWTKSYVLPEFPYDVKCMLAEQKCPDHSMRIRIIEFLQADMTKYLEGSLYPSTQQYNDVVNALLQAHPF    141 - 210
LDEDGCGFFLWKRALKDRFKYVRRPIEDDEQVIRNKCKFGHRRGQTRKSLADIRFDEIKLVQIKEEAVCF    211 - 280
DSELDEHIKWFQQEYVKTEKDWREIDKRMSQTLEIRRKMIGSRTPLKDILKLFPFLKCPYQMFREFQLLT    281 - 350
RTDIYKKTRHILESYSENILTSFSVVDNPINIVLQEKMKHYTDEDMLKYMKMTATCLLLPDVFGDDPSLF    351 - 420
VIMNEQVQVSTPVLEVKNPFNMEVCEFSLYLERERLTKVDDCVTALAALVAAFHVFRIECPRRLSQTFNF    421 - 490
LETLIFDMHSPYFPSLKEKENEVGFQHPLT                                            491 - 520
//

Text Mined References (13)

PMID Year Title