Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary


No data available


Accession Q8N6K4 B2R6Y3


 Compartment GO Term (1)

AA Sequence

YPWPPPARNRPATLPPTSRVSPLAAFLASAPQR                                         141 - 173

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.