Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N6K4 B2R6Y3
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MGDLPWAPPEAQAPSTAGAGDVAEHQVAPARFLQGAWRQAAGWLCRETGAAPGSAQAGPPETAHAADPQP      1 - 70
RGPQAPPRLPPSLSPERVHPGQPAAPAEPAPGAPALRSGPSQPRGLRLPVPVPACAGSSAPGSPAALPDS     71 - 140
YPWPPPARNRPATLPPTSRVSPLAAFLASAPQR                                         141 - 173
//

Text Mined References (2)

PMID Year Title