Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.57035668727401E-7
tuberculosis and treatment for 6 months 686 1.52879299193875E-5
ovarian cancer 8492 1.36439375759955E-4
pediatric high grade glioma 2712 1.91814626303934E-4
primitive neuroectodermal tumor 3031 0.00163572887752298
psoriasis 6685 0.002928460115174
group 3 medulloblastoma 2254 0.0056746782239232
osteosarcoma 7933 0.0112810884122281
glioblastoma 5572 0.0184697135126006

Synonym

Accession Q8N6I4 J3KQ65 Q9Y4S5
Symbols C14orf109

Gene

  Ortholog (13)

AA Sequence

MPKPPDYSELSDSLTLAVGTGRFSGPLHRAWRMMNFRQRMGWIGVGLYLLASAAAFYYVFEISETYNRLA      1 - 70
LEHIQQHPEEPLEGTTWTHSLKAQLLSLPFWVWTVIFLVPYLQMFLFLYSCTRADPKTVGYCIIPICLAV     71 - 140
ICNRHQAFVKASNQISRLQLIDT                                                   141 - 163
//

Text Mined References (4)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.