Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.100 5.9e-06
group 3 medulloblastoma 1.400 5.7e-03
osteosarcoma 1.067 1.1e-02
ovarian cancer 2.000 1.4e-04
pediatric high grade glioma 1.100 1.9e-04
posterior fossa group A ependymoma 1.100 1.6e-07
primitive neuroectodermal tumor 1.100 1.6e-03
psoriasis 1.100 2.9e-03
tuberculosis -1.100 1.6e-03

AA Sequence

MPKPPDYSELSDSLTLAVGTGRFSGPLHRAWRMMNFRQRMGWIGVGLYLLASAAAFYYVFEISETYNRLA      1 - 70
LEHIQQHPEEPLEGTTWTHSLKAQLLSLPFWVWTVIFLVPYLQMFLFLYSCTRADPKTVGYCIIPICLAV     71 - 140
ICNRHQAFVKASNQISRLQLIDT                                                   141 - 163
//

Text Mined References (4)

PMID Year Title