Property Summary

NCBI Gene PubMed Count 5
PubMed Score 21.13
PubTator Score 20.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
oligodendroglioma 2850 2.8e-02
astrocytic glioma 2597 3.0e-02
Disease Target Count Z-score Confidence
Salpingitis 6 3.425 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.200 3.0e-02
oligodendroglioma -1.300 2.8e-02

Gene RIF (1)

AA Sequence

MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAAREGRMAAARAAP      1 - 70
AAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEGPEGRPRSRHGNGGLAALPYL     71 - 140
RLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDAEYQRNPHRVDLDILTF    141 - 210
TIALTASEVINPLIEELGCDKFINRE                                                211 - 236
//

Text Mined References (9)

PMID Year Title