Property Summary

NCBI Gene PubMed Count 5
PubMed Score 20.29
PubTator Score 20.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 0.0275414877810761
astrocytic glioma 2241 0.0301892534101549
Disease Target Count Z-score Confidence
Salpingitis 6 3.472 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.200 0.030
oligodendroglioma -1.300 0.028

Synonym

Accession Q8N6I1 A7YQ71 Q6X7T0 Q6ZR61 EID-2
Symbols CRI2
EID-2

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

Gene RIF (1)

PMID Text
14612439 EID-2 may function as an endogenous suppressor of TGF-beta signaling

AA Sequence

MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAAREGRMAAARAAP      1 - 70
AAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEGPEGRPRSRHGNGGLAALPYL     71 - 140
RLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDAEYQRNPHRVDLDILTF    141 - 210
TIALTASEVINPLIEELGCDKFINRE                                                211 - 236
//

Text Mined References (9)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15970276 2005 A novel EID family member, EID-3, inhibits differentiation and forms a homodimer or heterodimer with EID-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612439 2004 A novel E1A-like inhibitor of differentiation (EID) family member, EID-2, suppresses transforming growth factor (TGF)-beta signaling by blocking TGF-beta-induced formation of Smad3-Smad4 complexes.
14585496 2003 EID-2, a novel member of the EID family of p300-binding proteins inhibits transactivation by MyoD.
12586827 2003 A novel EID-1 family member, EID-2, associates with histone deacetylases and inhibits muscle differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.