Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.09
PubTator Score 8.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gestational trophoblastic neoplasm 17 3.229 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 1.4e-05

Gene RIF (6)

AA Sequence

MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDS      1 - 70
NWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSS     71 - 140
AVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPNTDLLGTSPKASLELKS    141 - 210
SIIGKKKPAAAKKGLGAKKGLGAQKVSSQSFSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQE    211 - 280
LQIDRKKEEKKLQNLEGKKREQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGT    281 - 350
FASGPPKYKDNPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE    351 - 420
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSLGNVLPTADIA    421 - 490
QFKQGVKSVAGKMAVLANGVMNSLQDRYGSY                                           491 - 521
//

Text Mined References (25)

PMID Year Title