Property Summary

NCBI Gene PubMed Count 14
Grant Count 7
R01 Count 5
Funding $540,270.5
PubMed Score 10.09
PubTator Score 8.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 0.000

Gene RIF (6)

PMID Text
25496667 Genome-wide shRNA screening identifies ARFGAP2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22375848 analysis of the distinct role of subcomplexes of the COPI coat in the regulation of ArfGAP2 activity
20858901 ARFGAP2 and ARFGAP3 are essential for COPI coat assembly on the Golgi membrane of living cells.
19299515 ArfGAP1, ArfGAP2, and ArfGAP3 have overlapping roles in regulating COPI function in Golgi-to-ER retrograde transport.
19015319 Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking
17760859 human ARFGAP2 and ARFGAP3 are associated with COP-I-coated vesicles and function in COP I traffic

AA Sequence

MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELDS      1 - 70
NWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLWIDNMSS     71 - 140
AVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPNTDLLGTSPKASLELKS    141 - 210
SIIGKKKPAAAKKGLGAKKGLGAQKVSSQSFSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQE    211 - 280
LQIDRKKEEKKLQNLEGKKREQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGT    281 - 350
FASGPPKYKDNPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE    351 - 420
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSLGNVLPTADIA    421 - 490
QFKQGVKSVAGKMAVLANGVMNSLQDRYGSY                                           491 - 521
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22375848 2012 Distinct role of subcomplexes of the COPI coat in the regulation of ArfGAP2 activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20858901 2010 ARFGAP2 and ARFGAP3 are essential for COPI coat assembly on the Golgi membrane of living cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19299515 2009 Three homologous ArfGAPs participate in coat protein I-mediated transport.
More...