Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.87
PubTator Score 4.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 1.02522942063109E-5
osteosarcoma 7933 6.61886710045231E-5
interstitial cystitis 2299 1.75004534044403E-4
medulloblastoma, large-cell 6234 4.16631365370651E-4
ovarian cancer 8492 8.30080684322674E-4
atypical teratoid / rhabdoid tumor 4369 8.92951978578874E-4
Rheumatoid Arthritis 1171 0.00242692433764132
primary Sjogren syndrome 789 0.00337734254652635
glioblastoma 5572 0.00975338551506687
gastric carcinoma 832 0.0134001633371126
active Crohn's disease 918 0.0153308456628394
ependymoma 2514 0.0184779172113734
progressive supranuclear palsy 674 0.0276809750190967
Disease Target Count Z-score Confidence
Intestinal disease 11 0.0 2.0

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.002
ependymoma 1.300 0.018
osteosarcoma 1.661 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
glioblastoma 1.100 0.010
medulloblastoma, large-cell 1.400 0.000
active Crohn's disease 1.095 0.015
interstitial cystitis 1.100 0.000
primary Sjogren syndrome 1.400 0.003
progressive supranuclear palsy -1.100 0.028
gastric carcinoma 1.500 0.013
ulcerative colitis 2.400 0.000
ovarian cancer 2.300 0.001

Synonym

Accession Q8N6G5 B3KWL7 Q6MZJ5 Q6MZP6 Q8TCH4 Q9P1I6
Symbols CHGN2
ChGn-2
PRO0082
GALNACT2
GALNACT-2
beta4GalNAcT

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Gene RIF (2)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)
12446672 plays a role in the initiation and elongation in the synthesis of chondroitin sulfate

AA Sequence

MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQALLQEQEEHYQT      1 - 70
RATSLKRQIAQLKQELQEMSEKMRSLQERRNVGANGIGYQSNKEQAPSDLLEFLHSQIDKAEVSIGAKLP     71 - 140
SEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDELVEVIEAGLEVINNPDEDDEQEDEEGPLGEK    141 - 210
LIFNENDFVEGYYRTERDKGTQYELFFKKADLTEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAE    211 - 280
RTEAFVQFMQNFRDVCIHQDKKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLN    281 - 350
VGARAWDKGEVLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH    351 - 420
KKDSGFWRDFGFGMTCQYRSDFLTIGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPGLFHLWHEKRC    421 - 490
ADELTPEQYRMCIQSKAMNEASHSHLGMLVFREEIETHLHKQAYRTNSEAVG                      491 - 542
//

Text Mined References (22)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25582753 2015 Expression of the functional recombinant human glycosyltransferase GalNAcT2 in Escherichia coli.
25416956 2014 A proteome-scale map of the human interactome network.
25310821 2014 A genome-wide association study identifies potential susceptibility loci for Hirschsprung disease.
24548782 2014 The prognostic role of intragenic copy number breakpoints and identification of novel fusion genes in paediatric high grade glioma.
24280246 2014 Alterations in the chondroitin sulfate chain in human osteoarthritic cartilage of the knee.
22590693 2012 Simultaneous siRNA-mediated silencing of pairs of genes coding for enzymes involved in glycosaminoglycan synthesis.
19946888 2010 Defining the membrane proteome of NK cells.
19298595 2009 Expression of genes encoding for proteins involved in heparan sulphate and chondroitin sulphate chain synthesis and modification in normal and malignant plasma cells.
19196962 2009 Genome-wide association study identifies NRG1 as a susceptibility locus for Hirschsprung's disease.
More...