Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.27
PubTator Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 4.200 0.000
adult high grade glioma 1.200 0.000
pilocytic astrocytoma 1.400 0.000

Synonym

Accession Q8N6G2
Symbols C13orf26

Gene

 Compartment GO Term (1)

AA Sequence

MEQPGPRAPDPSLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQT      1 - 70
QYSDEYTWKSHSKEDLIKTETSRGIKSHKSHLNEDIFLWTLPHCQQTGTLKNCLPWKIPASMKEVNKALS     71 - 140
NQFISLTKRDFVDRSKAQKIKKSSHLSLEWKKLLPQPPDTEFRRNYQIPAKIPELQDFSFKYGCYSSLPV    141 - 210
ASQGLVPSVLHSYLRNQEHTKKQTTYQSDYDKTYPDFLMLLNSFTSSQVKEYLQSLSYKDRQIIDRFIRT    211 - 280
HCDTNKKKK                                                                 281 - 289
//

Text Mined References (4)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.