Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.27
PubTator Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 1.0e-05
adult high grade glioma 3801 4.6e-04
ependymoma 4679 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.200 4.6e-04
Astrocytoma, Pilocytic 1.400 1.0e-05
ependymoma 2.200 3.4e-02

Synonym

Accession Q8N6G2
Symbols C13orf26

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MEQPGPRAPDPSLCHHNLQPTDDPNWDSYATTMRTAFTPKTGAVPALIRQNGIRRLGYTYSLSDPILNQT      1 - 70
QYSDEYTWKSHSKEDLIKTETSRGIKSHKSHLNEDIFLWTLPHCQQTGTLKNCLPWKIPASMKEVNKALS     71 - 140
NQFISLTKRDFVDRSKAQKIKKSSHLSLEWKKLLPQPPDTEFRRNYQIPAKIPELQDFSFKYGCYSSLPV    141 - 210
ASQGLVPSVLHSYLRNQEHTKKQTTYQSDYDKTYPDFLMLLNSFTSSQVKEYLQSLSYKDRQIIDRFIRT    211 - 280
HCDTNKKKK                                                                 281 - 289
//

Text Mined References (4)

PMID Year Title