Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N6G1
Symbols C1orf211
NCRNA00337

 Compartment GO Term (0)

AA Sequence

MGIEKRFNVLKIKVTQLQCHMGRRPGCECSWELRAPVTVASFLWSPTDSGHLPLLQDTSGPPEGTHRTFT      1 - 70
PGRELVLGPKPTVPGKPFLASALLNV                                                 71 - 96
//

Text Mined References (2)

PMID Year Title