Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N6G1
Symbols C1orf211
NCRNA00337

Gene

 Compartment GO Term (0)

AA Sequence

MGIEKRFNVLKIKVTQLQCHMGRRPGCECSWELRAPVTVASFLWSPTDSGHLPLLQDTSGPPEGTHRTFT      1 - 70
PGRELVLGPKPTVPGKPFLASALLNV                                                 71 - 96
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.