Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.17
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.4e-18
osteosarcoma 7950 2.5e-08

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.191 2.5e-08
psoriasis -1.500 2.4e-18

AA Sequence

MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSAL      1 - 70
ILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGA     71 - 140
LSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSW    141 - 210
LPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK                                       211 - 245
//

Text Mined References (7)

PMID Year Title