Property Summary

NCBI Gene PubMed Count 27
PubMed Score 37.79
PubTator Score 23.04

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.3e-07
primary Sjogren syndrome 735 4.1e-04
medulloblastoma, large-cell 6241 8.7e-04
Disease Target Count Z-score Confidence
Lymphoma 81 3.959 2.0


  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 8.7e-04
osteosarcoma -1.302 8.3e-07
primary Sjogren syndrome 1.100 4.1e-04


Accession Q8N6F7 C9JD17 C9JUG6
Symbols HGAL


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

AA Sequence

ARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL                                    141 - 178

Text Mined References (30)

PMID Year Title