Property Summary

NCBI Gene PubMed Count 27
Grant Count 10
R01 Count 9
Funding $527,255.73
PubMed Score 34.90
PubTator Score 23.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.302 0.000
medulloblastoma, large-cell 1.100 0.001
primary Sjogren syndrome 1.100 0.000

Gene RIF (19)

PMID Text
25381061 These findings further elucidate the growing and complex role of HGAL in B-cell biology and suggest that membrane-bound and cytoplasmic HGAL protein differently regulates distinct biological processes.
25203428 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
23299888 the germinal centre protein human germinal centre-associated lymphoma regulates B-cell receptor signalling in B-lymphocytes which, without appropriate control, may lead to B-cell lymphoproliferation.
22914613 HGAL and LMO2 may be useful adjuncts in the identification of follicular lymphoma of the nongastric gastrointestinal tract.
22743653 HGAL/GCET2 protein expression may function as a marker for germinal center B-cell type diffuse large B-cell lymphoma.
21988858 Immunostaining for HGAL was more frequently positive than that for BCL6 and CD10 in follicular lymphomas
21722313 Data suggest that both HGAL and LMO2 are directly regulated by the transcription repressor PRDM1--overexpression of PRDM1 down-regulates HGAL and LMO2; PRDM1 directly binds to promoters of both HGAL and LMO2 and represses genetic transcription.
21502424 HGAL is sensitive and specific marker for detecting follicular lymphoma in nodal and extranodal sites
21475040 necessary for germinal center maintenance and confining B-cells to the germinal center microenvironment
21447067 show that HGAL increases the binding of myosin to F-actin and inhibits the ability of myosin to translocate actin by reducing the maximal velocity of myosin head/actin movement
More...

AA Sequence

MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSST      1 - 70
PIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRH     71 - 140
ARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL                                    141 - 178
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25381061 2015 HGAL localization to cell membrane regulates B-cell receptor signaling.
25203428 2015 Diagnostic Utility of the Germinal Center-associated Markers GCET1, HGAL, and LMO2 in Hematolymphoid Neoplasms.
23299888 2013 Germinal centre protein HGAL promotes lymphoid hyperplasia and amyloidosis via BCR-mediated Syk activation.
22914613 2013 Usefulness of HGAL and LMO2 immunohistochemistry in the identification of follicular lymphomas of the non-gastric gastrointestinal tract.
22743653 2012 The contribution of HGAL/GCET2 in immunohistological algorithms: a comparative study in 424 cases of nodal diffuse large B-cell lymphoma.
21988858 2011 Comparison of germinal center markers CD10, BCL6 and human germinal center-associated lymphoma (HGAL) in follicular lymphomas.
21722313 2011 PRDM1/Blimp1 downregulates expression of germinal center genes LMO2 and HGAL.
21502424 2011 The efficacy of HGAL and LMO2 in the separation of lymphomas derived from small B cells in nodal and extranodal sites, including the bone marrow.
21475040 2011 HGAL protein expression persists in disorders of germinal center dissolution: potential role of HGAL in the germinal center microenvironment.
More...