Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.66
PubTator Score 20.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 3.1e-05
inflammatory breast cancer -1.100 2.1e-07
medulloblastoma, large-cell 1.700 2.6e-06
osteosarcoma 1.097 1.0e-03
psoriasis -1.400 9.6e-22

Gene RIF (10)

AA Sequence

MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL      1 - 70
LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY     71 - 140
ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREP    141 - 210
VVKLPASAKGPLGV                                                            211 - 224
//

Text Mined References (23)

PMID Year Title