Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.413 2.6e-04
adult high grade glioma -2.400 2.3e-04
aldosterone-producing adenoma -1.849 1.8e-02
astrocytic glioma -1.500 4.2e-03
Astrocytoma, Pilocytic -2.700 1.6e-08
atypical teratoid / rhabdoid tumor -3.000 9.4e-06
Breast cancer -4.800 2.2e-02
breast carcinoma -1.200 5.4e-30
ductal carcinoma in situ -1.900 1.4e-04
ependymoma -1.400 4.3e-02
glioblastoma -2.300 2.5e-07
group 3 medulloblastoma -1.200 2.5e-02
head and neck cancer -1.400 1.8e-02
interstitial lung disease -1.400 2.6e-02
intraductal papillary-mucinous adenoma (... 1.800 1.9e-03
invasive ductal carcinoma -3.000 2.9e-05
lung adenocarcinoma -2.100 6.5e-15
lung carcinoma -2.900 2.1e-26
medulloblastoma, large-cell -3.000 1.3e-04
nasopharyngeal carcinoma 1.400 3.8e-02
non-small cell lung cancer -3.495 6.8e-35
oligodendroglioma -1.400 2.2e-10
osteosarcoma -3.052 1.5e-03
ovarian cancer -3.500 7.5e-17
Pick disease -1.400 9.7e-07
primary Sjogren syndrome 1.200 2.4e-03
primitive neuroectodermal tumor -2.800 2.5e-05

Synonym

Accession Q8N6D5 B2R972 Q6ZWE8 Q96LU9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MCRMSFKKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHIDCVRELVLQGA      1 - 70
DINLQRESGTTALFFAAQQGHNDVVRFLFGFGASTEFRTKDGGTALLAASQYGHMQVVETLLKHGANIHD     71 - 140
QLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPRQDGTAPLWIASQMGHSEVVRVMLLRGADRDAARND    141 - 210
GTTALLKAANKGYNDVIKELLKFSPTLGILKNGTSALHAAVLSGNIKTVALLLEAGADPSLRNKANELPA    211 - 280
ELTKNERILRLLRSKEGPRKS                                                     281 - 301
//

Text Mined References (8)

PMID Year Title