Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.73
PubTator Score 1.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 9.02901604371933E-15
non-small cell lung cancer 2798 3.74696036667086E-9
posterior fossa group A ependymoma 1511 9.43595233012484E-5
subependymal giant cell astrocytoma 2287 0.00307534712021346
osteosarcoma 7933 0.00433430286173463
medulloblastoma, large-cell 6234 0.0051100507677384
Breast cancer 3099 0.0115560697757945
spina bifida 1064 0.0345855386838441

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.599 0.004
medulloblastoma, large-cell -1.200 0.005
non-small cell lung cancer -1.131 0.000
lung adenocarcinoma -1.100 0.000
posterior fossa group A ependymoma 1.100 0.000
subependymal giant cell astrocytoma -2.430 0.003
spina bifida -1.477 0.035
Breast cancer 1.600 0.012

Synonym

Accession Q8N6D2 B2RDG2 Q8NBG3
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

AA Sequence

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFE      1 - 70
TCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRES     71 - 140
SPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVT    141 - 210
LGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS                                     211 - 247
//

Text Mined References (11)

PMID Year Title
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
18298843 2008 A novel brain-enriched E3 ubiquitin ligase RNF182 is up regulated in the brains of Alzheimer's patients and targets ATP6V0C for degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...