Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.73
PubTator Score 1.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.600 1.2e-02
lung adenocarcinoma -1.100 9.0e-15
medulloblastoma, large-cell -1.200 5.1e-03
non-small cell lung cancer -1.131 3.7e-09
osteosarcoma -2.599 4.3e-03
posterior fossa group A ependymoma 1.100 9.4e-05
spina bifida -1.477 3.5e-02
subependymal giant cell astrocytoma -2.430 3.1e-03

AA Sequence

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFE      1 - 70
TCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRES     71 - 140
SPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVT    141 - 210
LGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS                                     211 - 247
//

Text Mined References (11)

PMID Year Title