Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.73
PubTator Score 1.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.599 0.004
medulloblastoma, large-cell -1.200 0.005
non-small cell lung cancer -1.131 0.000
lung adenocarcinoma -1.100 0.000
posterior fossa group A ependymoma 1.100 0.000
subependymal giant cell astrocytoma -2.430 0.003
spina bifida -1.477 0.035
Breast cancer 1.600 0.012

AA Sequence

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFE      1 - 70
TCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRES     71 - 140
SPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVT    141 - 210
LGVVFVSLVPSSLVILMVYGFCQCVCHEFLDCMAPPS                                     211 - 247
//

Text Mined References (11)

PMID Year Title
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
18298843 2008 A novel brain-enriched E3 ubiquitin ligase RNF182 is up regulated in the brains of Alzheimer's patients and targets ATP6V0C for degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...